Stock Number Hs1452

Human Gene: ETNK2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ETNK2 ethanolamine kinase 2 HGNC:25575 1q32.1 eas X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03721 pGW-HA.attB ENST00000367202.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166203884844

Sequences

DNA sequence (1392 bp) Protein sequence (464 aa)
ATGGCTGTGCCCCCTTCGGCCCCTCAGCCGCGCGCGTCCTTTCACCTGAG
GAGGCACACGCCTTGCCCGCAGTGCTCATGGGGCATGGAGGAGAAGGCGG
CGGCCAGCGCCAGCTGCCGGGAGCCGCCGGGCCCCCCGAGGGCCGCCGCC
GTCGCGTACTTCGGCATTTCCGTGGACCCGGACGACATCCTTCCCGGGGC
CCTGCGCCTCATCCAGGAGCTGCGGCCGCATTGGAAACCCGAGCAAGTTC
GGACCAAGCGCTTCACGGATGGCATCACCAACAAGCTGGTGGCCTGCTAT
GTGGAGGAGGACATGCAGGACTGCGTGCTGGTCCGGGTGTATGGGGAGCG
GACGGAGCTGCTGGTGGACCGGGAGAATGAGGTCAGAAACTTCCAGCTGC
TGCGAGCACACAGCTGTGCCCCCAAACTCTACTGCACCTTCCAGAATGGG
CTGTGCTATGAGTACATGCAGGGTGTGGCCCTGGAGCCTGAGCACATCCG
TGAGCCCCGGCTTTTCAGGTTAATCGCCTTAGAAATGGCAAAGATTCATA
CTATCCACGCCAACGGCAGCCTGCCCAAGCCCATCCTCTGGCACAAGATG
CACAATTATTTCACGCTTGTGAAGAACGAGATCAACCCCAGCCTTTCTGC
AGATGTCCCTAAGGTAGAGGTGTTGGAACGGGAGCTGGCCTGGCTGAAGG
AGCATCTGTCCCAGCTGGAGTCCCCTGTGGTGTTTTGTCACAATGACCTG
CTCTGCAAGAATATCATCTATGACAGCATCAAAGGTCACGTGCGGTTCAT
TGACTATGAATATGCTGGCTACAACTACCAAGCTTTTGACATTGGCAACC
ATTTCAATGAGTTTGCAGGCGTGAATGAGGTGGATTACTGCCTGTACCCG
GCGCGGGAGACCCAGCTGCAGTGGCTGCACTACTACCTGCAGGCACAAAA
GGGGATGGCCGTGACCCCCAGGGAGGTGCAAAGGCTCTACGTGCAAGTCA
ACAAGTTTGCCCTGGCGTCTCACTTCTTCTGGGCTCTCTGGGCCCTCATC
CAGAACCAGTACTCCACCATCGACTTTGATTTCCTCAGGTACGCAGTGAT
CCGATTCAACCAGTACTTCAAGGTGAAGCCTCAAGCGTCAGCCTTGGAGA
TGCCAAAGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCC
TATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGG
CGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTT
ACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGAC
TATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAA
VAYFGISVDPDDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACY
VEEDMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCAPKLYCTFQNG
LCYEYMQGVALEPEHIREPRLFRLIALEMAKIHTIHANGSLPKPILWHKM
HNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDL
LCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYP
ARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALI
QNQYSTIDFDFLRYAVIRFNQYFKVKPQASALEMPKCPTFLYKVVVPRSS
YSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPD
YAGSYPYDVPDYA*

Index