Stock Number Hs1451

Human Gene: IKBKB


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
IKBKB inhibitor of nuclear factor kappa B kinase subunit beta HGNC:5960 8p11.21 IKKbeta 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03880 pGW-HA.attB ENST00000523517.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166203784843

Sequences

DNA sequence (1494 bp) Protein sequence (498 aa)
ATGAGCTGGTCACCTTCCCTGACAACGCAGACATGTGGGGCCTGGGAAAT
GAAAGAGCGCCTTGGGACAGGGGGATTTGGAAATGTCATCCGATGGCACA
ATCAGGAAACAGGTGAGCAGATTGCCATCAAGCAGTGCCGGCAGGAGCTC
AGCCCCCGGAACCGAGAGCGGTGGTGCCTGGAGATCCAGATCATGAGAAG
GCTGACCCACCCCAATGTGGTGGCTGCCCGAGATGTCCCTGAGGGGATGC
AGAACTTGGCGCCCAATGACCTGCCCCTGCTGGCCATGGAGTACTGCCAA
GGAGGAGATCTCCGGAAGTACCTGAACCAGTTTGAGAACTGCTGTGGTCT
GCGGGAAGGTGCCATCCTCACCTTGCTGAGTGACATTGCCTCTGCGCTTA
GATACCTTCATGAAAACAGAATCATCCATCGGGATCTAAAGCCAGAAAAC
ATCGTCCTGCAGCAAGGAGAACAGAGGTTAATACACAAAATTATTGACCT
AGGATATGCCAAGGAGCTGGATCAGGGCAGTCTTTGCACATCATTCGTGG
GGACCCTGCAGTACCTGGCCCCAGAGCTACTGGAGCAGCAGAAGTACACA
GTGACCGTCGACTACTGGAGCTTCGGCACCCTGGCCTTTGAGTGCATCAC
GGGCTTCCGGCCCTTCCTCCCCAACTGGCAGCCCGTGCAGTGGCATTCAA
AAGTGCGGCAGAAGAGTGAGGTGGACATTGTTGTTAGCGAAGACTTGAAT
GGAACGGTGAAGTTTTCAAGCTCTTTACCCTACCCCAATAATCTTAACAG
TGTCCTGGCTGAGCGACTGGAGAAGTGGCTGCAACTGATGCTGATGTGGC
ACCCCCGACAGAGGGGCACGGATCCCACGTATGGGCCCAATGGCTGCTTC
AAGGCCCTGGATGACATCTTAAACTTAAAGCTGGTTCATATCTTGAACAT
GGTCACGGGCACCATCCACACCTACCCTGTGACAGAGGATGAGAGTCTGC
AGAGCTTGAAGGCCAGAATCCAACAGGACACGGGCATCCCAGAGGAGGAC
CAGGAGCTGCTGCAGGAAGCGGGCCTGGCGTTGATCCCCGATAAGCCTGC
CACTCAGTGTATTTCAGACGGCAAGGTGAGCCCTGGCTTCGTACACACCA
TCCTGTTTACCTTGGCTGTGCCTCCTGGGAAACTCAACACACTTTCAGAT
TTCAATTCTGCTTTGTCATGTAGTCTGTTAATCACACAGTGCGGATACCT
GGCTGGTTTTTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTT
CCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGA
GGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAAT
TTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGG
ACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQEL
SPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQ
GGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPEN
IVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT
VTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLN
GTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED
QELLQEAGLALIPDKPATQCISDGKVSPGFVHTILFTLAVPPGKLNTLSD
FNSALSCSLLITQCGYLAGFLPTFLYKVVVPRSSYSLLSIGTSILGAPSG
GGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index