Stock Number Hs1450

Human Gene: NFIB


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NFIB nuclear factor I B HGNC:7785 9p23-p22.3 NfI 4

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03879 pGW-HA.attB ENST00000380959.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166203684842

Sequences

DNA sequence (1494 bp) Protein sequence (498 aa)
ATGATGTATTCTCCCATCTGTCTCACTCAGGATGAATTTCACCCATTCAT
CGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACC
TGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGA
AATCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATA
TTCGCCAGGAGTATCGAGAGGACTTTGTGCTCACCGTGACTGGCAAGAAG
CACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAG
AATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCA
TGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGG
CTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACA
TCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACG
TGCAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCT
GCCAAGAATCCTCCAGGTTACCTTGAGGATAGTTTTGTAAAATCTGGAGT
CTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGG
GAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTAT
CATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACC
AAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAATATGGAACCAA
GTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGT
CGAACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAA
GAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAGGATTCTTCCC
CAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCC
ATTTCCAACACAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTC
ATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGATACTCTGAAG
AACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTG
GTACCTGGGCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTT
CCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGA
GGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAAT
TTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGG
ACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMS
KDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKK
HPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGER
LMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDP
AKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYY
HDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGS
RTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLK
NYVPSYDPSSPQTSQSWYLGYPTFLYKVVVPRSSYSLLSIGTSILGAPSG
GGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index