Stock Number Hs1449

Human Gene: SYT2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SYT2 synaptotagmin 2 HGNC:11510 1q32.1 Syt1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03878 pGW-HA.attB ENST00000367267.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166203584841

Sequences

DNA sequence (1491 bp) Protein sequence (497 aa)
ATGAGGAACATTTTCAAGAGGAACCAGGAGCCTATTGTGGCTCCTGCCAC
CACCACCGCCACGATGCCCATTGGACCCGTGGACAACTCCACTGAGAGTG
GGGGTGCTGGGGAGAGCCAGGAGGACATGTTTGCCAAACTGAAGGAGAAG
TTATTCAATGAGATAAACAAGATTCCCTTACCACCCTGGGCACTGATCGC
CATTGCTGTGGTTGCTGGGCTCCTGCTTCTCACCTGCTGCTTCTGCATCT
GCAAGAAATGCTGCTGCAAGAAGAAGAAGAACAAGAAGGAGAAGGGCAAA
GGCATGAAGAATGCCATGAACATGAAGGACATGAAAGGGGGTCAGGATGA
CGACGACGCAGAGACAGGCCTGACTGAGGGGGAAGGTGAAGGGGAGGAGG
AGAAAGAGCCAGAGAACCTGGGCAAACTGCAGTTTTCCCTGGACTATGAT
TTTCAGGCTAATCAGCTTACTGTGGGCGTTCTGCAGGCTGCTGAACTGCC
TGCCCTGGACATGGGAGGCACCTCAGACCCTTATGTCAAGGTCTTCCTCC
TTCCTGACAAGAAGAAGAAATATGAGACCAAAGTCCATCGGAAGACACTG
AACCCTGCCTTCAATGAAACCTTCACCTTCAAGGTGCCATACCAGGAGCT
GGGGGGCAAAACTCTGGTGATGGCCATCTATGACTTTGACCGCTTCTCCA
AACATGACATCATTGGAGAGGTAAAGGTGCCTATGAACACAGTGGACCTC
GGCCAGCCCATTGAGGAGTGGAGAGACCTGCAAGGCGGGGAAAAGGAGGA
GCCGGAGAAGCTGGGCGACATCTGCACCTCCCTGCGCTATGTGCCCACGG
CCGGGAAGCTCACTGTCTGCATCCTGGAGGCTAAGAACCTCAAGAAGATG
GACGTGGGCGGCCTTTCAGACCCGTACGTGAAGATCCACCTGATGCAGAA
TGGCAAGAGGCTCAAGAAGAAGAAGACAACCGTGAAGAAGAAGACCCTGA
ACCCATACTTCAACGAGTCCTTCAGCTTTGAGATCCCCTTCGAGCAGATT
CAGAAAGTCCAGGTAGTGGTCACCGTGCTGGACTATGACAAGCTGGGCAA
GAACGAAGCCATAGGCAAGATCTTCGTGGGCAGCAATGCCACGGGCACAG
AGCTGCGGCACTGGTCCGACATGCTGGCCAACCCCCGGAGGCCCATCGCC
CAGTGGCACTCGCTCAAGCCTGAGGAGGAGGTGGATGCACTCCTGGGCAA
GAACAAGTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCT
ATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGC
GGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTA
CCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACT
ATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEK
LFNEINKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGK
GMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYD
FQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTL
NPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDL
GQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKM
DVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQI
QKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIA
QWHSLKPEEEVDALLGKNKLPTFLYKVVVPRSSYSLLSIGTSILGAPSGG
GATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index