Stock Number Hs1447

Human Gene: ACTR3B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ACTR3B ARP3 actin related protein 3 homolog B HGNC:17256 7q36.1-q36.2 Arp3 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03874 pGW-HA.attB ENST00000256001.12 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166203384840

Sequences

DNA sequence (1488 bp) Protein sequence (496 aa)
ATGGCAGGCTCCCTGCCTCCCTGCGTGGTGGACTGTGGCACCGGGTATAC
CAAGCTTGGCTACGCAGGCAACACTGAGCCCCAGTTCATTATTCCTTCAT
GTATTGCCATCAGAGAGTCAGCAAAGGTAGTTGACCAAGCTCAAAGGAGA
GTGTTGAGGGGAGTTGATGACCTTGACTTTTTCATAGGAGATGAAGCCAT
CGATAAACCTACATATGCTACAAAGTGGCCGATACGACATGGAATCATTG
AAGACTGGGATCTTATGGAAAGGTTCATGGAGCAAGTGGTTTTTAAATAT
CTTCGAGCTGAACCTGAGGACCATTATTTTTTAATGACAGAACCTCCACT
CAATACACCAGAAAACAGAGAGTATCTTGCAGAAATTATGTTTGAATCAT
TTAACGTACCAGGACTCTACATTGCAGTTCAGGCAGTGCTGGCCTTGGCG
GCATCTTGGACATCTCGACAAGTGGGTGAACGTACGTTAACGGGGATAGT
CATTGACAGCGGAGATGGAGTCACCCATGTTATCCCAGTGGCAGAAGGTT
ATGTAATTGGAAGCTGCATCAAACACATCCCGATTGCAGGTAGAGATATT
ACGTATTTCATTCAACAGCTGCTAAGGGAGAGGGAGGTGGGAATCCCTCC
TGAGCAGTCACTGGAGACCGCAAAAGCCATTAAGGAGAAATACTGTTACA
TTTGCCCCGATATAGTCAAGGAATTTGCCAAGTATGATGTGGATCCCCGG
AAGTGGATCAAACAGTACACGGGTATCAATGCGATCAACCAGAAGAAGTT
TGTTATAGACGTTGGTTACGAAAGATTCCTGGGACCTGAAATATTCTTTC
ACCCGGAGTTTGCCAACCCAGACTTTATGGAGTCCATCTCAGATGTTGTT
GATGAAGTAATACAGAACTGCCCCATCGATGTGCGGCGCCCGCTGTATAA
GAATGTCGTACTCTCAGGAGGCTCCACCATGTTCAGGGATTTCGGACGCC
GACTGCAGAGGGATTTGAAGAGAGTGGTGGATGCTAGGCTGAGGCTCAGC
GAGGAGCTCAGCGGCGGGAGGATCAAGCCGAAGCCTGTGGAGGTCCAGGT
GGTCACGCATCACATGCAGCGCTACGCCGTGTGGTTCGGAGGCTCCATGC
TGGCCTCGACTCCCGAGTTCTTTCAGGTCTGCCACACCAAGAAGGACTAT
GAAGAGTACGGGCCCAGCATCTGCCGCCACAACCCCGTCTTTGGAGTCAT
GTCCTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATT
CTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGT
GCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCC
ATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATG
CAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR
VLRGVDDLDFFIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKY
LRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALA
ASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDI
TYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPR
KWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS
EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDY
EEYGPSICRHNPVFGVMSYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGG
ATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index