Stock Number Hs1446

Human Gene: ACTR3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ACTR3 ARP3 actin related protein 3 homolog HGNC:170 2q14.1 Arp3 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03869 pGW-HA.attB ENST00000443297.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166203284839

Sequences

DNA sequence (1488 bp) Protein sequence (496 aa)
ATGGCGGGACGGCTGCCGGCCTGTGTGGTGGACTGTGGCACGGGGTATAC
AAAACTAGGATATGCTGGAAATACAGAACCACAGTTTATCATCCCTTCCT
GTATTGCTATTAAGGAGTCAGCAAAAGTGGGTGATCAAGCTCAAAGGAGG
GTGATGAAAGGTGTTGATGACCTAGACTTCTTCATTGGTGATGAAGCAAT
AGAAAAACCTACATATGCAACAAAGTGGCCAATCCGCCATGGTATAGTTG
AAGATTGGGACTTAATGGAAAGGTTTATGGAGCAAGTGATCTTTAAATAT
TTAAGGGCAGAACCTGAAGACCATTATTTTCTTTTGACTGAACCTCCATT
GAATACTCCAGAAAACAGGGAATATACTGCTGAAATAATGTTTGAGTCCT
TCAATGTTCCAGGCTTGTACATTGCTGTGCAGGCTGTTCTTGCCTTAGCT
GCATCTTGGACCTCAAGACAAGTAGGAGAACGGACGTTGACCGGTACGGT
AATAGACAGTGGAGATGGTGTCACTCATGTCATTCCTGTGGCTGAAGGGT
ATGTGATTGGCAGCTGTATTAAACACATTCCAATCGCAGGACGAGATATA
ACATATTTTATTCAGCAACTGCTGAGAGACCGAGAAGTAGGAATCCCTCC
AGAACAATCCTTGGAAACTGCTAAGGCAGTAAAGGAGCGCTATAGTTATG
TCTGCCCAGATTTAGTAAAAGAATTTAACAAGTATGATACAGATGGGTCA
AAATGGATTAAACAGTATACTGGAATCAATGCTATCTCAAAGAAAGAGTT
TTCTATCGATGTTGGTTATGAGAGATTTTTGGGACCTGAAATCTTTTTTC
ATCCAGAGTTTGCTAATCCAGACTTTACACAACCTATCTCAGAAGTTGTA
GATGAAGTAATTCAGAATTGTCCTATTGATGTCAGACGTCCTCTCTACAA
GAATATTGTCCTCTCTGGAGGTTCAACCATGTTCAGGGACTTTGGACGTC
GCTTGCAAAGAGATTTGAAAAGAACTGTAGATGCCCGGCTGAAATTAAGT
GAGGAATTGAGTGGTGGTAGATTGAAGCCAAAACCTATTGATGTACAAGT
CATTACACACCACATGCAGCGATATGCAGTTTGGTTTGGAGGATCAATGC
TGGCTTCCACGCCTGAGTTCTACCAAGTATGCCACACCAAAAAGGATTAT
GAAGAAATTGGACCTAGCATTTGTCGTCACAATCCAGTGTTTGGAGTCAT
GTCGTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATT
CTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGT
GCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCC
ATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATG
CAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRR
VMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKY
LRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALA
ASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDI
TYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGS
KWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLS
EELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDY
EEIGPSICRHNPVFGVMSYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGG
ATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index