Stock Number Hs1444

Human Gene: CALR


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CALR calreticulin HGNC:1455 19p13.13 Calr 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03866 pGW-HA.attB ENST00000316448.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166203084837

Sequences

DNA sequence (1485 bp) Protein sequence (495 aa)
ATGCTGCTATCCGTGCCGCTGCTGCTCGGCCTCCTCGGCCTGGCCGTCGC
CGAGCCTGCCGTCTACTTCAAGGAGCAGTTTCTGGACGGAGACGGGTGGA
CTTCCCGCTGGATCGAATCCAAACACAAGTCAGATTTTGGCAAATTCGTT
CTCAGTTCCGGCAAGTTCTACGGTGACGAGGAGAAAGATAAAGGTTTGCA
GACAAGCCAGGATGCACGCTTTTATGCTCTGTCGGCCAGTTTCGAGCCTT
TCAGCAACAAAGGCCAGACGCTGGTGGTGCAGTTCACGGTGAAACATGAG
CAGAACATCGACTGTGGGGGCGGCTATGTGAAGCTGTTTCCTAATAGTTT
GGACCAGACAGACATGCACGGAGACTCAGAATACAACATCATGTTTGGTC
CCGACATCTGTGGCCCTGGCACCAAGAAGGTTCATGTCATCTTCAACTAC
AAGGGCAAGAACGTGCTGATCAACAAGGACATCCGTTGCAAGGATGATGA
GTTTACACACCTGTACACACTGATTGTGCGGCCAGACAACACCTATGAGG
TGAAGATTGACAACAGCCAGGTGGAGTCCGGCTCCTTGGAAGACGATTGG
GACTTCCTGCCACCCAAGAAGATAAAGGATCCTGATGCTTCAAAACCGGA
AGACTGGGATGAGCGGGCCAAGATCGATGATCCCACAGACTCCAAGCCTG
AGGACTGGGACAAGCCCGAGCATATCCCTGACCCTGATGCTAAGAAGCCC
GAGGACTGGGATGAAGAGATGGACGGAGAGTGGGAACCCCCAGTGATTCA
GAACCCTGAGTACAAGGGTGAGTGGAAGCCCCGGCAGATCGACAACCCAG
ATTACAAGGGCACTTGGATCCACCCAGAAATTGACAACCCCGAGTATTCT
CCCGATCCCAGTATCTATGCCTATGATAACTTTGGCGTGCTGGGCCTGGA
CCTCTGGCAGGTCAAGTCTGGCACCATCTTTGACAACTTCCTCATCACCA
ACGATGAGGCATACGCTGAGGAGTTTGGCAACGAGACGTGGGGCGTAACA
AAGGCAGCAGAGAAACAAATGAAGGACAAACAGGACGAGGAGCAGAGGCT
TAAGGAGGAGGAAGAAGACAAGAAACGCAAAGAGGAGGAGGAGGCAGAGG
ACAAGGAGGATGATGAGGACAAAGATGAGGATGAGGAGGATGAGGAGGAC
AAGGAGGAAGATGAGGAGGAAGATGTCCCCGGCCAGGCCAAGGACGAGCT
GTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTC
TACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCT
ACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATA
CGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAG
GATCCTATCCATATGACGTTCCAGATTACGCTTGA
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFV
LSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHE
QNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNY
KGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW
DFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKP
EDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT
KAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEED
KEEDEEEDVPGQAKDELYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGA
TAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index