Stock Number Hs1443

Human Gene: CHST5


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CHST5 carbohydrate sulfotransferase 5 HGNC:1973 16q23.1 CG31637 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03839 pGW-HA.attB ENST00000336257.7 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166202984836

Sequences

DNA sequence (1467 bp) Protein sequence (489 aa)
ATGGGCATGAGGGCCCGGGTCCCTAAAGTTGCCCACTCCACCCGAAGGCC
CCCAGCCGCCCGCATGTGGCTGCCACGGTTCTCCAGCAAGACAGTGACAG
TGCTCCTCCTGGCACAGACCACCTGCCTCCTGCTCTTCATCATCTCCCGG
CCAGGGCCCTCATCCCCAGCCGGCGGCGAGGATCGTGTGCACGTGCTGGT
GCTGTCCTCGTGGCGCTCGGGCTCATCCTTCTTGGGCCAGCTCTTCAGCC
AGCACCCCGACGTCTTCTACCTGATGGAGCCCGCGTGGCATGTGTGGACC
ACCCTGTCGCAGGGCAGCGCGGCAACGCTGCACATGGCCGTGCGCGACCT
GATGCGCTCTATCTTTTTGTGCGACATGGACGTGTTTGATGCCTACATGC
CACAGAGCCGAAACCTGTCCGCCTTTTTCAACTGGGCAACGAGCCGCGCG
CTGTGCTCGCCGCCCGCCTGCAGCGCCTTTCCCCGAGGCACCATCAGCAA
GCAGGACGTATGCAAGACACTGTGCACGCGGCAGCCATTCAGCCTGGCCC
GGGAGGCCTGCCGCTCCTACAGCCACGTGGTGCTCAAGGAGGTGCGCTTC
TTCAACCTGCAGGTGCTCTACCCGCTGCTCAGCGACCCCGCGCTCAACCT
GCGCATCGTGCACCTGGTGCGCGACCCGCGGGCCGTGCTGCGCTCCCGGG
AGGCGGCGGGCCCGATACTGGCACGCGACAACGGCATCGTGCTGGGCACC
AACGGCAAGTGGGTGGAGGCCGACCCTCACCTGCGCCTGATTCGCGAGGT
GTGCCGCAGCCACGTGCGCATCGCCGAGGCCGCCACACTCAAGCCGCCAC
CCTTCCTGCGCGGCCGCTACCGCCTGGTGCGCTTCGAGGACCTGGCGCGG
GAGCCGCTGGCAGAGATCCGCGCACTCTACGCCTTCACCGGCCTGACCCT
CACGCCACAGCTCGAGGCCTGGATCCACAACATCACCCACGGGTCGGGGA
TCGGCAAGCCAATCGAGGCCTTCCATACTTCGTCTAGGAATGCGCGCAAC
GTCTCCCAGGCCTGGCGCCACGCGTTGCCCTTCACTAAGATCCTGCGCGT
GCAGGAGGTGTGCGCCGGCGCGCTGCAGCTGCTGGGCTACCGGCCTGTGT
ACTCTGCGGACCAGCAGCGTGACCTCACCCTGGATCTGGTGCTGCCACGA
GGCCCAGACCACTTCAGCTGGGCATCGCCTGACTTGCCAACTTTCTTGTA
CAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTT
CCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGA
GCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTTGA
MGMRARVPKVAHSTRRPPAARMWLPRFSSKTVTVLLLAQTTCLLLFIISR
PGPSSPAGGEDRVHVLVLSSWRSGSSFLGQLFSQHPDVFYLMEPAWHVWT
TLSQGSAATLHMAVRDLMRSIFLCDMDVFDAYMPQSRNLSAFFNWATSRA
LCSPPACSAFPRGTISKQDVCKTLCTRQPFSLAREACRSYSHVVLKEVRF
FNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREAAGPILARDNGIVLGT
NGKWVEADPHLRLIREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAR
EPLAEIRALYAFTGLTLTPQLEAWIHNITHGSGIGKPIEAFHTSSRNARN
VSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPR
GPDHFSWASPDLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGG
AGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index