Stock Number Hs1442

Human Gene: LAMP1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
LAMP1 lysosomal associated membrane protein 1 HGNC:6499 13q34 Lamp1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03863 pGW-HA.attB ENST00000332556.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK331662028

Sequences

DNA sequence (1485 bp) Protein sequence (495 aa)
ATGGCGGCCCCCGGCAGCGCCCGGCGACCCCTGCTGCTGCTACTGCTGTT
GCTGCTGCTCGGCCTCATGCATTGTGCGTCAGCAGCAATGTTTATGGTGA
AAAATGGCAACGGGACCGCGTGCATAATGGCCAACTTCTCTGCTGCCTTC
TCAGTGAACTACGACACCAAGAGTGGCCCTAAGAACATGACCTTTGACCT
GCCATCAGATGCCACAGTGGTGCTCAACCGCAGCTCCTGTGGAAAAGAGA
ACACTTCTGACCCCAGTCTCGTGATTGCTTTTGGAAGAGGACATACACTC
ACTCTCAATTTCACGAGAAATGCAACACGTTACAGCGTCCAGCTCATGAG
TTTTGTTTATAACTTGTCAGACACACACCTTTTCCCCAATGCGAGCTCCA
AAGAAATCAAGACTGTGGAATCTATAACTGACATCAGGGCAGATATAGAT
AAAAAATACAGATGTGTTAGTGGCACCCAGGTCCACATGAACAACGTGAC
CGTAACGCTCCATGATGCCACCATCCAGGCGTACCTTTCCAACAGCAGCT
TCAGCAGGGGAGAGACACGCTGTGAACAAGACAGGCCTTCCCCAACCACA
GCGCCCCCTGCGCCACCCAGCCCCTCGCCCTCACCCGTGCCCAAGAGCCC
CTCTGTGGACAAGTACAACGTGAGCGGCACCAACGGGACCTGCCTGCTGG
CCAGCATGGGGCTGCAGCTGAACCTCACCTATGAGAGGAAGGACAACACG
ACGGTGACAAGGCTTCTCAACATCAACCCCAACAAGACCTCGGCCAGCGG
GAGCTGCGGCGCCCACCTGGTGACTCTGGAGCTGCACAGCGAGGGCACCA
CCGTCCTGCTCTTCCAGTTCGGGATGAATGCAAGTTCTAGCCGGTTTTTC
CTACAAGGAATCCAGTTGAATACAATTCTTCCTGACGCCAGAGACCCTGC
CTTTAAAGCTGCCAACGGCTCCCTGCGAGCGCTGCAGGCCACAGTCGGCA
ATTCCTACAAGTGCAACGCGGAGGAGCACGTCCGTGTCACGAAGGCGTTT
TCAGTCAATATATTCAAAGTGTGGGTCCAGGCTTTCAAGGTGGAAGGTGG
CCAGTTTGGCTCTGTGGAGGAGTGTCTGCTGGACGAGAACAGCATGCTGA
TCCCCATCGCTGTGGGTGGTGCCCTGGCGGGGCTGGTCCTCATCGTCCTC
ATCGCCTACCTCGTCGGCAGGAAGAGGAGTCACGCAGGCTACCAGACTAT
CTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTC
TACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCT
ACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATA
CGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAG
GATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAF
SVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTL
TLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADID
KKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTT
APPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT
TVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF
SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVL
IAYLVGRKRSHAGYQTIYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGA
TAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index