Stock Number Hs1441

Human Gene: BCAT2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
BCAT2 branched chain amino acid transaminase 2 HGNC:977 19q13.33 CG1673 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03653 pGW-HA.attB ENST00000597011.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166202784835

Sequences

DNA sequence (1410 bp) Protein sequence (470 aa)
ATGGCCGCAGCCGCTCTGGGGCAGATCTGGGCACGAAAGCTTCTCTCTGT
CCCTTGGCTTCTGTGTGGTCCCAGAAGATATGCCTCCTCCAGTTTCAAGG
CTGCAGACCTGCAGCTGGAAATGACACAGAAGCCTCATAAGAAGCCTGGC
CCCGGCGAGCCCCTGGTGTTTGGGAAGACATTTACCGACCACATGCTGAT
GGTGGAATGGAATGACAAGGGCTGGGGCCAGCCCCGAATCCAGCCCTTCC
AGAACCTCACGCTGCACCCAGCCTCCTCCAGCCTCCACTACTCCCTGCAG
CTGTTTGAGGGCATGAAGGCGTTCAAAGGCAAAGACCAGCAGGTGCGCCT
CTTCCGCCCCTGGCTCAACATGGACCGGATGCTGCGCTCAGCCATGCGCC
TGTGCCTGCCGAGTTTCGACAAGCTGGAGTTGCTGGAGTGCATCCGCCGG
CTCATCGAAGTGGACAAGGACTGGGTCCCCGATGCCGCCGGCACCAGCCT
CTATGTGCGGCCTGTGCTCATTGGGAACGAGCCCTCGCTGGGTGTCAGCC
AGCCCACGCGCGCGCTCCTGTTCGTCATTCTCTGCCCAGTGGGTGCCTAC
TTCCCTGGAGGCTCCGTGACCCCGGTCTCCCTCCTGGCCGACCCAGCCTT
CATCCGGGCCTGGGTGGGCGGGGTCGGCAACTACAAGTTAGGTGGGAATT
ATGGGCCCACCGTGTTAGTGCAACAGGAGGCACTCAAGCGGGGCTGTGAA
CAGGTCCTCTGGCTGTATGGGCCCGACCACCAGCTCACCGAGGTGGGAAC
CATGAACATCTTTGTCTACTGGACCCACGAAGATGGGGTGCTGGAGCTGG
TGACGCCCCCGCTGAATGGTGTTATCCTGCCTGGAGTGGTCAGACAGAGT
CTACTGGACATGGCTCAGACCTGGGGTGAGTTCCGGGTGGTGGAGCGCAC
GATCACCATGAAGCAGTTGCTGCGGGCCCTGGAGGAGGGCCGCGTGCGGG
AAGTCTTTGGCTCGGGCACCGCTTGCCAGGTCTGCCCAGTGCACCGAATC
CTGTACAAAGACAGGAACCTCCACATTCCCACCATGGAAAATGGGCCTGA
GCTGATCCTCCGCTTCCAGAAGGAGCTGAAGGAGATCCAGTACGGAATCA
GAGCCCACGAGTGGATGTTCCCGGTGTGCCCAACTTTCTTGTACAAAGTG
GTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCT
TGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTG
GACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTAT
CCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGA
TTACGCTTGA
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPG
PGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQ
LFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRR
LIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAY
FPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCE
QVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI
LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPVCPTFLYKV
VVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGY
PYDVPDYAGSYPYDVPDYA*

Index