Stock Number Hs1439

Human Gene: DPF2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DPF2 double PHD fingers 2 HGNC:9964 11q13.1 d4 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03642 pGW-HA.attB ENST00000528416.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166202584834

Sequences

DNA sequence (1407 bp) Protein sequence (469 aa)
ATGGCGGCTGTGGTGGAGAATGTAGTGAAGCTCCTTGGGGAGCAGTACTA
CAAAGATGCCATGGAGCAGTGCCACAATTACAATGCTCGCCTCTGTGCTG
AGCGCAGCGTGCGCCTGCCTTTCTTGGACTCACAGACCGGAGTAGCCCAG
AGCAATTGTTACATCTGGATGGAAAAGCGACACCGGGGTCCAGGATTGGC
CTCCGGACAGCTGTACTCCTACCCTGCCCGGCGCTGGCGGAAAAAGCGGC
GAGCCCATCCCCCTGAGGATCCACGACTTTCCTTCCCATCTATTAAGCCA
GACACAGACCAGACCCTGAAGAAGGAGGGGCTGATCTCTCAGGATGGCAG
TAGTTTAGAGGCTCTGTTGCGCACTGACCCCCTGGAGAAGCGAGGTGCCC
CGGATCCCCGAGTTGATGATGACAGCCTGGGCGAGTTTCCTGTGACCAAC
AGTCGAGCGCGAAAGCGGATCCTAGAACCAGATGACTTCCTGGATGACCT
CGATGATGAAGACTATGAAGAAGATACTCCCAAGCGTCGGGGAAAGGGGA
AATCCAAGGGTAAGGGTGTGGGCAGTGCCCGTAAGAAGCTGGATGCTTCC
ATCCTGGAGGACCGGGATAAGCCCTATGCCTGTGACATTTGTGGAAAACG
TTACAAGAACCGACCAGGCCTCAGTTACCACTATGCCCACTCCCACTTGG
CTGAGGAGGAGGGCGAGGACAAGGAAGACTCTCAACCACCCACTCCTGTT
TCCCAGAGGTCTGAGGAGCAGAAATCCAAAAAGGGTCCTGATGGATTGGC
CTTGCCCAACAACTACTGTGACTTCTGCCTGGGGGACTCAAAGATTAACA
AGAAGACGGGACAACCCGAGGAGCTGGTGTCCTGTTCTGACTGTGGCCGC
TCAGGGCATCCATCTTGCCTCCAATTTACCCCCGTGATGATGGCGGCAGT
GAAGACATACCGCTGGCAGTGCATCGAGTGCAAATGTTGCAATATCTGCG
GCACCTCCGAGAATGACGACCAGTTGCTCTTCTGTGATGACTGCGATCGT
GGCTACCACATGTACTGTCTCACCCCGTCCATGTCTGAGCCCCCTGAAGG
AAGTTGGAGCTGCCACCTGTGTCTGGACCTGTTGAAAGAGAAAGCTTCCA
TCTACCAGAACCAGAACTCCTCTTGCCCAACTTTCTTGTACAAAGTGGTG
GTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGG
AGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGAC
CTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCC
TATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTA
CGCTTGA
MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ
SNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKP
DTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTN
SRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDAS
ILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPV
SQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDR
GYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSSCPTFLYKVV
VPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYP
YDVPDYAGSYPYDVPDYA*

Index