Stock Number Hs1438

Human Gene: RMND5A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RMND5A required for meiotic nuclear division 5 homolog A HGNC:25850 2p11.2 CG3295 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03641 pGW-HA.attB ENST00000283632.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166202484833

Sequences

DNA sequence (1407 bp) Protein sequence (469 aa)
ATGGATCAGTGCGTGACGGTGGAGCGCGAGCTGGAGAAGGTGCTGCACAA
GTTCTCAGGCTACGGGCAGCTGTGCGAGCGCGGCCTGGAGGAGCTCATCG
ACTACACCGGCGGCCTCAAGCACGAGATCCTGCAGAGCCACGGCCAAGAT
GCTGAATTATCAGGGACACTTTCACTTGTTTTGACACAGTGCTGTAAAAG
AATAAAGGATACTGTTCAAAAATTGGCCTCCGACCACAAAGACATCCACA
GCAGTGTTTCTCGGGTTGGAAAAGCCATTGATAAGAATTTTGATTCTGAC
ATTAGCAGTGTGGGAATAGATGGCTGCTGGCAGGCAGACAGCCAAAGGCT
TCTCAATGAAGTGATGGTGGAGCACTTCTTTCGACAAGGAATGCTGGATG
TGGCTGAGGAGCTCTGTCAGGAATCTGGTCTTTCTGTAGACCCAAGTCAG
AAGGAACCATTTGTGGAGTTAAATAGAATATTAGAGGCATTAAAGGTCAG
AGTTCTGAGACCTGCTCTGGAGTGGGCAGTGTCAAACCGGGAAATGCTTA
TAGCTCAAAACAGCTCCTTGGAATTTAAGCTACACAGACTGTATTTTATT
AGCTTGTTAATGGGTGGAACCACAAATCAGCGAGAGGCATTACAATATGC
TAAAAATTTTCAGCCATTTGCCCTAAATCATCAAAAAGACATTCAGGTTT
TGATGGGAAGCCTTGTGTACCTGAGACAAGGGATTGAGAACTCACCATAT
GTTCACCTACTTGATGCAAACCAGTGGGCTGATATCTGTGACATCTTTAC
ACGGGATGCTTGTGCCCTCCTGGGGCTCTCCGTGGAGTCCCCTCTCAGTG
TCAGTTTCTCAGCAGGTTGTGTGGCGCTGCCAGCTTTAATTAACATCAAA
GCCGTGATTGAACAGAGGCAGTGTACTGGAGTTTGGAACCAGAAAGATGA
ATTACCTATTGAAGTGGACCTTGGTAAAAAGTGCTGGTATCACTCTATAT
TTGCCTGCCCCATTCTTCGTCAGCAAACAACAGATAACAATCCACCCATG
AAATTGGTCTGTGGTCATATTATATCAAGAGATGCCCTGAATAAAATGTT
TAATGGTAGCAAATTAAAATGTCCCTACTGTCCAATGGAACAAAGTCCAG
GAGATGCCAAACAGATATTTTTCTGCCCAACTTTCTTGTACAAAGTGGTG
GTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGG
AGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGAC
CTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCC
TATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTA
CGCTTGA
MDQCVTVERELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQD
AELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGKAIDKNFDSD
ISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAEELCQESGLSVDPSQ
KEPFVELNRILEALKVRVLRPALEWAVSNREMLIAQNSSLEFKLHRLYFI
SLLMGGTTNQREALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPY
VHLLDANQWADICDIFTRDACALLGLSVESPLSVSFSAGCVALPALINIK
AVIEQRQCTGVWNQKDELPIEVDLGKKCWYHSIFACPILRQQTTDNNPPM
KLVCGHIISRDALNKMFNGSKLKCPYCPMEQSPGDAKQIFFCPTFLYKVV
VPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYP
YDVPDYAGSYPYDVPDYA*

Index