Stock Number Hs1436

Human Gene: FEZ1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
FEZ1 fasciculation and elongation protein zeta 1 HGNC:3659 11q24.2 Unc-76 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03751 pGW-HA.attB ENST00000527534.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166202284832

Sequences

DNA sequence (1410 bp) Protein sequence (470 aa)
ATGGAGGCCCCACTGGTGAGTCTGGATGAAGAGTTTGAGGACCTTCGACC
CTCCTGCTCGGAGGACCCGGAGGAGAAGCCCCAGTGTTTCTATGGTTCAT
CTCCCCACCATCTCGAGGACCCCTCCCTCTCCGAGCTTGAGAATTTTTCT
TCCGAAATAATCAGCTTCAAGTCCATGGAGGACCTCGTAAATGAATTTGA
TGAGAAGCTCAATGTCTGCTTTCGGAACTACAACGCCAAGACCGAGAACC
TAGCTCCCGTGAAGAACCAGTTACAGATCCAAGAGGAGGAGGAGACCCTT
CAGGACGAGGAGGTTTGGGATGCTCTGACAGACAATTACATCCCTTCACT
CTCAGAAGACTGGAGGGATCCAAACATCGAGGCTCTGAATGGCAACTGCT
CTGACACTGAGATCCATGAGAAAGAAGAGGAAGAGTTCAATGAGAAGAGT
GAAAATGATTCCGGTATCAACGAGGAGCCTCTGCTCACAGCAGATCAGGT
AATTGAGGAGATTGAGGAAATGATGCAGAACTCCCCAGACCCTGAGGAAG
AAGAGGAGGTTCTGGAAGAAGAGGATGGAGGAGAAACTTCCTCCCAGGCA
GACTCGGTCCTCCTGCAGGAGATGCAGGCATTGACACAGACCTTCAACAA
CAACTGGTCCTATGAAGGGCTGAGGCACATGTCTGGGTCTGAGCTGACCG
AGCTGCTGGACCAGGTGGAGGGTGCCATCCGTGACTTCTCGGAGGAGCTG
GTGCAGCAGCTGGCCCGCCGGGACGAGCTGGAGTTTGAGAAGGAAGTGAA
GAACTCCTTTATCACGGTGCTTATTGAGGTTCAGAACAAGCAGAAGGAGC
AGCGAGAACTGATGAAAAAGAGGCGGAAAGAGAAAGGGCTGAGCCTGCAG
AGCAGCCGGATAGAGAAGGGAAACCAGATGCCTCTCAAGCGCTTCAGCAT
GGAAGGCATCTCCAACATTCTGCAGAGTGGCATCCGCCAGACCTTTGGCT
CCTCAGGAACTGACAAACAGTATCTGAACACAGTCATTCCTTACGAGAAG
AAAGCCTCTCCTCCCTCAGTGGAAGACCTGCAGATGCTGACAAACATTCT
CTTTGCCATGAAGGAGGATAATGAGAAGGTGCCTACTTTGCTAACGGACT
ACATTTTAAAAGTGCTCTGCCCTACCTACCCAACTTTCTTGTACAAAGTG
GTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCT
TGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTG
GACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTAT
CCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGA
TTACGCTTGA
MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFS
SEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETL
QDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKS
ENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQA
DSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEEL
VQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQ
SSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEK
KASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPTYPTFLYKV
VVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGY
PYDVPDYAGSYPYDVPDYA*

Index