Stock Number Hs1435

Human Gene: MITF


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
MITF melanogenesis associated transcription factor HGNC:7105 3p13 Mitf 4

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03951 pGW-HA.attB ENST00000314557.10 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166202184831

Sequences

DNA sequence (1473 bp) Protein sequence (491 aa)
ATGCTGGAAATGCTAGAATATAATCACTATCAGGTGCAGACCCACCTCGA
AAACCCCACCAAGTACCACATACAGCAAGCCCAACGGCAGCAGGTAAAGC
AGTACCTTTCTACCACTTTAGCAAATAAACATGCCAACCAAGTCCTGAGC
TTGCCATGTCCAAACCAGCCTGGCGATCATGTCATGCCACCGGTGCCGGG
GAGCAGCGCACCCAACAGCCCCATGGCTATGCTTACGCTTAACTCCAACT
GTGAAAAAGAGGGATTTTATAAGTTTGAAGAGCAAAACAGGGCAGAGAGC
GAGTGCCCAGGCATGAACACACATTCACGAGCGTCCTGTATGCAGATGGA
TGATGTAATCGATGACATCATTAGCCTAGAATCAAGTTATAATGAGGAAA
TCTTGGGCTTGATGGATCCTGCTTTGCAAATGGCAAATACGTTGCCTGTC
TCGGGAAACTTGATTGATCTTTATGGAAACCAAGGTCTGCCCCCACCAGG
CCTCACCATCAGCAACTCCTGTCCAGCCAACCTTCCCAACATAAAAAGGG
AGCTCACAGAGTCTGAAGCAAGAGCACTGGCCAAAGAGAGGCAGAAAAAG
GACAATCACAACCTGATTGAACGAAGAAGAAGATTTAACATAAATGACCG
CATTAAAGAACTAGGTACTTTGATTCCCAAGTCAAATGATCCAGACATGC
GCTGGAACAAGGGAACCATCTTAAAAGCATCCGTGGACTATATCCGAAAG
TTGCAACGAGAACAGCAACGCGCAAAAGAACTTGAAAACCGACAGAAGAA
ACTGGAGCACGCCAACCGGCATTTGTTGCTCAGAATACAGGAACTTGAAA
TGCAGGCTCGAGCTCATGGACTTTCCCTTATTCCATCCACGGGTCTCTGC
TCTCCAGATTTGGTGAATCGGATCATCAAGCAAGAACCCGTTCTTGAGAA
CTGCAGCCAAGACCTCCTTCAGCATCATGCAGACCTAACCTGTACAACAA
CTCTCGATCTCACGGATGGCACCATCACCTTCAACAACAACCTCGGAACT
GGGACTGAGGCCAACCAAGCCTATAGTGTCCCCACAAAAATGGGATCCAA
ACTGGAAGACATCCTGATGGACGACACCCTTTCTCCCGTCGGTGTCACTG
ATCCACTCCTTTCCTCAGTGTCCCCCGGAGCTTCCAAAACAAGCAGCCGG
AGGAGCAGTATGAGCATGGAAGAGACGGAGCACACTTGTTACCCAACTTT
CTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAG
GAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCT
GGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGA
CTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCAT
ATGACGTTCCAGATTACGCTTGA
MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLS
LPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAES
ECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLPV
SGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTESEARALAKERQKK
DNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRK
LQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLC
SPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGT
GTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSR
RSSMSMEETEHTCYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGA
GGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index