Stock Number Hs1434

Human Gene: ZNF260


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ZNF260 zinc finger protein 260 HGNC:13499 19q13.12 pad 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03942 pGW-HA.attB ENST00000588993.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166202084830

Sequences

DNA sequence (1470 bp) Protein sequence (490 aa)
ATGATAGGCATGTTGGAAAGTCTTCAGCATGAATCAGATCTCCTTCAGCA
TGATCAAATTCATACTGGAGAGAAACCTTATGAATGTAATGAATGTAGAA
AAACTTTTAGCCTGAAGCAAAACCTTGTAGAGCATAAGAAAATGCATACT
GGAGAGAAATCTCATGAATGCACTGAATGTGGTAAAGTGTGCTCTCGAGT
CTCATCTCTTACTCTACACCTTAGAAGTCACACAGGAAAGAAGGCATATA
AATGTAATAAATGTGGAAAAGCCTTCAGCCAGAAGGAAAACTTCCTTTCT
CATCAGAAACATCACACTGGAGAGAAACCTTATGAATGTGAAAAAGTTTC
TATTCAGATGCCAACCATCATCAGACACCAGAAAAATCATACAGGAACCA
AACCCTATGCATGTAAGGAATGTGGCAAAGCCTTTAACGGCAAAGCATAT
CTCACTGAGCATGAGAAAATTCATACTGGAGAAAAACCATTTGAATGTAA
TCAGTGTGGAAGAGCCTTCAGCCAGAAGCAATACCTCATTAAACATCAGA
ACATCCATACTGGAAAGAAGCCCTTTAAATGTAGTGAGTGTGGAAAAGCT
TTTAGCCAGAAGGAAAACCTCATTATACATCAGAGAATCCATACTGGAGA
GAAACCTTATGAATGTAAAGGGTGTGGGAAAGCTTTCATTCAGAAGTCAA
GCCTCATTAGACACCAGAGAAGTCACACAGGAGAGAAACCTTATACGTGT
AAGGAATGTGGGAAAGCCTTCAGTGGCAAGTCAAATCTCACAGAGCATGA
GAAAATTCATATTGGAGAGAAACCCTACAAATGTAATGAATGTGGAACAA
TCTTCAGGCAGAAGCAATACCTCATTAAACATCACAATATTCATACAGGA
GAGAAACCCTATGAATGTAATAAATGTGGAAAAGCCTTCTCTCGAATCAC
ATCACTTATTGTACATGTGAGAATTCATACAGGTGATAAGCCTTATGAGT
GTAAGGTCTGTGGGAAAGCCTTCTGTCAAAGCTCATCTCTTACTGTGCAT
ATGAGAAGCCATACAGGTGAGAAACCCTATGGTTGTAATGAATGTGGGAA
AGCCTTTTCTCAGTTCTCAACCCTTGCTCTGCACATGAGAATCCATACTG
GTGAAAAACCTTATCAGTGTAGTGAATGTGGGAAAGCTTTCAGCCAAAAG
TCGCATCACATTAGACACCAGAGAATTCATACCCATTTGCCAACTTTCTT
GTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAA
CTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGT
GGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTA
TGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATG
ACGTTCCAGATTACGCTTGA
MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHT
GEKSHECTECGKVCSRVSSLTLHLRSHTGKKAYKCNKCGKAFSQKENFLS
HQKHHTGEKPYECEKVSIQMPTIIRHQKNHTGTKPYACKECGKAFNGKAY
LTEHEKIHTGEKPFECNQCGRAFSQKQYLIKHQNIHTGKKPFKCSECGKA
FSQKENLIIHQRIHTGEKPYECKGCGKAFIQKSSLIRHQRSHTGEKPYTC
KECGKAFSGKSNLTEHEKIHIGEKPYKCNECGTIFRQKQYLIKHHNIHTG
EKPYECNKCGKAFSRITSLIVHVRIHTGDKPYECKVCGKAFCQSSSLTVH
MRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQK
SHHIRHQRIHTHLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAG
GAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index