Stock Number Hs1433

Human Gene: DPEP1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
DPEP1 dipeptidase 1 HGNC:3002 16q24.3 CG6154 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03938 pGW-HA.attB ENST00000261615.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166201984829

Sequences

DNA sequence (1467 bp) Protein sequence (489 aa)
ATGTGGAGCGGATGGTGGCTGTGGCCCCTTGTGGCCGTCTGCACTGCAGA
CTTCTTTCGGGACGAGGCAGAGAGGATCATGAGGGACTCCCCTGTCATTG
ATGGGCACAATGACCTCCCCTGGCAGCTGCTGGATATGTTCAACAACCGG
CTGCAGGACGAGAGGGCCAACCTGACCACCTTGGCCGGCACACACACCAA
CATCCCCAAGCTGAGGGCCGGCTTTGTGGGAGGCCAGTTCTGGTCCGTGT
ACACGCCCTGCGACACCCAGAACAAAGACGCCGTGCGGAGGACGCTGGAG
CAGATGGACGTGGTCCACCGCATGTGCCGGATGTACCCGGAGACCTTCCT
GTATGTCACCAGCAGTGCAGGCATTCGGCAGGCCTTCCGGGAAGGGAAGG
TGGCCAGCCTGATCGGCGTGGAGGGCGGCCACTCCATTGACAGCAGTTTG
GGCGTCCTGCGGGCACTCTATCAGCTGGGCATGCGGTACCTGACCCTCAC
CCACAGCTGCAACACGCCCTGGGCTGACAACTGGCTGGTGGACACGGGAG
ACAGCGAGCCCCAGAGCCAAGGCTTGTCACCCTTTGGGCAGCGTGTGGTG
AAGGAGCTGAACCGTCTGGGGGTCCTCATCGACTTGGCTCACGTGTCTGT
GGCCACCATGAAGGCCACCCTGCAGCTGTCCAGAGCCCCGGTCATCTTCA
GCCACTCCTCGGCCTACAGCGTGTGCGCAAGCCGGCGCAACGTGCCTGAC
GACGTCCTGAGGCTGGTGAAACAGACAGACAGCCTGGTGATGGTGAACTT
CTACAACAATTACATTTCCTGCACCAACAAGGCCAACCTGTCCCAAGTGG
CCGACCATCTGGATCACATCAAGGAGGTGGCAGGAGCCAGAGCCGTGGGT
TTTGGTGGGGACTTTGATGGTGTTCCAAGGGTCCCTGAGGGGCTGGAGGA
CGTCTCCAAGTATCCAGACCTGATCGCTGAGCTGCTCAGGAGGAACTGGA
CGGAGGCGGAGGTCAAGGGCGCACTGGCTGACAACCTGCTGAGGGTCTTC
GAGGCTGTGGAACAGGCCAGCAACCTCACACAGGCTCCCGAGGAGGAGCC
CATCCCGCTGGACCAGCTGGGTGGCTCCTGCAGGACCCATTACGGCTACT
CCTCTGGGGCTTCCAGCCTCCATCGCCACTGGGGGCTCCTGCTGGCCTCC
CTCGCTCCCCTGGTCCTCTGTCTGTCTCTCCTGTGCCCAACTTTCTTGTA
CAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTT
CCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGA
GCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTTGA
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNR
LQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLE
QMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSL
GVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVV
KELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPD
DVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVF
EAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLAS
LAPLVLCLSLLCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGG
AGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index