Stock Number Hs1432

Human Gene: RTN4


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RTN4 reticulon 4 HGNC:14085 2p16.1 Rtnl1 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03750 pGW-HA.attB ENST00000357732.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK331662018

Sequences

DNA sequence (1410 bp) Protein sequence (470 aa)
ATGGAAGACCTGGACCAGTCTCCTCTGGTCTCGTCCTCGGACAGCCCACC
CCGGCCGCAGCCCGCGTTCAAGTACCAGTTCGTGAGGGAGCCCGAGGACG
AGGAGGAAGAAGAGGAGGAGGAAGAGGAGGACGAGGACGAAGACCTGGAG
GAGCTGGAGGTGCTGGAGAGGAAGCCCGCCGCCGGGCTGTCCGCGGCCCC
AGTGCCCACCGCCCCTGCCGCCGGCGCGCCCCTGATGGACTTCGGAAATG
ACTTCGTGCCGCCGGCGCCCCGGGGACCCCTGCCGGCCGCTCCCCCCGTC
GCCCCGGAGCGGCAGCCGTCTTGGGACCCGAGCCCGGTGTCGTCGACCGT
GCCCGCGCCATCCCCGCTGTCTGCTGCCGCAGTCTCGCCCTCCAAGCTCC
CTGAGGACGACGAGCCTCCGGCCCGGCCTCCCCCTCCTCCCCCGGCCAGC
GTGAGCCCCCAGGCAGAGCCCGTGTGGACCCCGCCAGCCCCGGCTCCCGC
CGCGCCCCCCTCCACCCCGGCCGCGCCCAAGCGCAGGGGCTCCTCGGGCT
CAGTGGATGAGACCCTTTTTGCTCTTCCTGCTGCATCTGAGCCTGTGATA
CGCTCCTCTGCAGTTGTTGACCTCCTGTACTGGAGAGACATTAAGAAGAC
TGGAGTGGTGTTTGGTGCCAGCCTATTCCTGCTGCTTTCATTGACAGTAT
TCAGCATTGTGAGCGTAACAGCCTACATTGCCTTGGCCCTGCTCTCTGTG
ACCATCAGCTTTAGGATATACAAGGGTGTGATCCAAGCTATCCAGAAATC
AGATGAAGGCCACCCATTCAGGGCATATCTGGAATCTGAAGTTGCTATAT
CTGAGGAGTTGGTTCAGAAGTACAGTAATTCTGCTCTTGGTCATGTGAAC
TGCACGATAAAGGAACTCAGGCGCCTCTTCTTAGTTGATGATTTAGTTGA
TTCTCTGAAGTTTGCAGTGTTGATGTGGGTATTTACCTATGTTGGTGCCT
TGTTTAATGGTCTGACACTACTGATTTTGGCTCTCATTTCACTCTTCAGT
GTTCCTGTTATTTATGAACGGCATCAGGCACAGATAGATCATTATCTAGG
ACTTGCAAATAAGAATGTTAAAGATGCTATGGCTAAAATCCAAGCAAAAA
TCCCTGGATTGAAGCGCAAAGCTGAATGCCCAACTTTCTTGTACAAAGTG
GTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCT
TGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTG
GACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTAT
CCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGA
TTACGCTTGA
MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLE
ELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPV
APERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPAS
VSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVDETLFALPAASEPVI
RSSAVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSV
TISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVN
CTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFS
VPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAECPTFLYKV
VVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGY
PYDVPDYAGSYPYDVPDYA*

Index