Stock Number Hs1431

Human Gene: SH3BP5L


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SH3BP5L SH3 binding domain protein 5 like HGNC:29360 1q44 CG14408 X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03758 pGW-HA.attB ENST00000366472.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166201784828

Sequences

DNA sequence (1413 bp) Protein sequence (471 aa)
ATGGCTGAGCTCAGACAGGTTCCAGGAGGGCGGGAGACCCCACAGGGGGA
GCTGCGGCCTGAAGTTGTAGAGGATGAAGTCCCTAGGAGCCCAGTCGCAG
AAGAGCCTGGAGGAGGTGGAAGCAGCAGCAGTGAGGCCAAATTGTCCCCA
AGAGAGGAGGAAGAACTGGATCCTAGAATACAGGAGGAGTTGGAGCACCT
GAACCAGGCCAGCGAGGAGATCAACCAGGTGGAACTACAGCTGGATGAGG
CCAGGACCACCTATCGGAGGATCCTACAGGAGTCGGCGAGGAAACTGAAT
ACACAGGGTTCCCACTTGGGGAGCTGCATCGAGAAAGCCCGGCCCTACTA
TGAGGCTCGGCGGCTGGCTAAGGAGGCTCAGCAGGAGACACAGAAGGCAG
CGCTGCGGTACGAGCGGGCCGTAAGCATGCACAACGCTGCTCGAGAAATG
GTGTTTGTGGCTGAGCAGGGCGTCATGGCTGACAAGAACCGACTGGACCC
CACGTGGCAGGAGATGCTGAACCATGCTACCTGCAAGGTGAATGAGGCGG
AGGAAGAGCGGCTTCGAGGTGAGCGGGAGCACCAGCGAGTGACTCGGCTG
TGCCAACAGGCTGAGGCTCGGGTCCAAGCCCTGCAGAAGACCCTCCGGAG
GGCCATCGGCAAGAGCCGCCCCTACTTTGAGCTCAAGGCCCAGTTCAGCC
AGATCCTGGAGGAGCACAAGGCCAAGGTGACAGAACTGGAGCAGCAGGTA
GCTCAGGCCAAGACGCGCTACTCCGTGGCCCTTCGTAACCTGGAGCAGAT
CAGCGAGCAGATTCACGCACGGCGCCGCGGGGGTCTGCCTCCCCACCCCC
TGGGCCCTCGGCGCTCCTCCCCCGTGGGGGCCGAGGCAGGACCCGAGGAC
ATGGAGGACGGAGACAGCGGGATTGAGGGGGCCGAGGGTGCGGGGCTGGA
GGAGGGCAGCAGCCTGGGGCCCGGCCCCGCCCCCGACACCGATACCCTGA
GTCTGCTGAGCCTGCGCACGGTGGCTTCAGACCTGCAGAAGTGCGACTCC
GTGGAGCACTTGCGAGGCCTCTCGGACCACGTCAGTCTGGACGGCCAAGA
GCTGGGAACGCGGAGTGGAGGGCGCCGGGGCAGCGACGGCGGAGCCCGTG
GGGGTCGGCACCAGCGCAGCGTCAGCCTGTACCCAACTTTCTTGTACAAA
GTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCAT
CCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCG
GTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGC
TATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCC
AGATTACGCTTGA
MAELRQVPGGRETPQGELRPEVVEDEVPRSPVAEEPGGGGSSSSEAKLSP
REEEELDPRIQEELEHLNQASEEINQVELQLDEARTTYRRILQESARKLN
TQGSHLGSCIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHNAAREM
VFVAEQGVMADKNRLDPTWQEMLNHATCKVNEAEEERLRGEREHQRVTRL
CQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQV
AQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPED
MEDGDSGIEGAEGAGLEEGSSLGPGPAPDTDTLSLLSLRTVASDLQKCDS
VEHLRGLSDHVSLDGQELGTRSGGRRGSDGGARGGRHQRSVSLYPTFLYK
VVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAG
YPYDVPDYAGSYPYDVPDYA*

Index