Stock Number Hs1429

Human Gene: FAM20B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
FAM20B FAM20B, glycosaminoglycan xylosylkinase HGNC:23017 1q25.2 CG3631 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03827 pGW-HA.attB ENST00000263733.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166201584827

Sequences

DNA sequence (1461 bp) Protein sequence (487 aa)
ATGAAGCTAAAGCAGCGAGTCGTGCTGTTAGCAATTCTCCTTGTCATTTT
TATCTTCACCAAAGTTTTCCTGATTGACAACTTAGATACATCAGCTGCCA
ACCGGGAGGACCAGAGGGCCTTTCACCGAATGATGACTGGCTTGCGGGTG
GAGCTGGCACCCAAGCTGGACCATACCTTGCAGTCTCCCTGGGAGATTGC
AGCCCAGTGGGTGGTTCCCCGGGAAGTGTACCCTGAAGAGACACCAGAGC
TGGGGGCAGTCATGCATGCCATGGCCACCAAGAAAATCATTAAAGCTGAT
GTGGGTTATAAAGGGACACAGCTGAAAGCCTTACTGATACTTGAAGGAGG
CCAGAAAGTTGTTTTCAAACCTAAGCGGTATAGCCGAGACCATGTGGTGG
AAGGGGAACCGTATGCTGGTTATGATAGACACAATGCAGAGGTAGCAGCC
TTTCACTTGGACAGGATTCTGGGTTTCCACCGAGCCCCCTTGGTAGTTGG
CAGATTTGTTAATCTTCGGACAGAGATCAAACCTGTCGCCACAGAGCAGC
TGTTGAGCACCTTCCTAACTGTAGGAAACAATACTTGTTTTTATGGGAAG
TGCTATTACTGCCGAGAAACAGAACCAGCTTGTGCTGATGGAGACATAAT
GGAGGGATCTGTCACACTTTGGCTTCCAGATGTGTGGCCTCTGCAGAAGC
ACCGTCACCCATGGGGCAGGACTTACCGAGAAGGCAAATTGGCCAGGTGG
GAGTATGATGAGAGCTACTGTGATGCTGTGAAGAAAACGTCCCCTTATGA
CTCTGGCCCGCGCCTCTTGGACATCATTGACACAGCTGTCTTTGATTACC
TGATTGGCAATGCTGACCGCCATCACTATGAGAGCTTTCAAGATGATGAA
GGCGCTAGTATGCTCATCCTTCTTGATAATGCCAAAAGCTTTGGGAACCC
CTCGCTGGATGAAAGAAGCATTCTTGCCCCTCTCTATCAGTGTTGCATCA
TTCGGGTGTCCACCTGGAACAGACTGAACTACCTAAAGAATGGTGTGCTA
AAGTCTGCCTTAAAATCTGCCATGGCCCATGACCCCATCTCCCCAGTGCT
CTCTGATCCTCATCTGGACGCCGTGGACCAGCGGCTCCTGAGTGTCCTGG
CCACCGTGAAGCAGTGCACCGACCAGTTTGGGATGGACACAGTACTGGTG
GAAGACAGGATGCCTCTCTCACACTTGTACCCAACTTTCTTGTACAAAGT
GGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCC
TTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGT
GGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTA
TCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAG
ATTACGCTTGA
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRV
ELAPKLDHTLQSPWEIAAQWVVPREVYPEETPELGAVMHAMATKKIIKAD
VGYKGTQLKALLILEGGQKVVFKPKRYSRDHVVEGEPYAGYDRHNAEVAA
FHLDRILGFHRAPLVVGRFVNLRTEIKPVATEQLLSTFLTVGNNTCFYGK
CYYCRETEPACADGDIMEGSVTLWLPDVWPLQKHRHPWGRTYREGKLARW
EYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDE
GASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVL
KSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLV
EDRMPLSHLYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAG
GPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index