Stock Number Hs1428

Human Gene: BMP4


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
BMP4 bone morphogenetic protein 4 HGNC:1071 14q22.2 dpp 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03826 pGW-HA.attB ENST00000559642.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166201484826

Sequences

DNA sequence (1458 bp) Protein sequence (486 aa)
ATGATTCCTGGTAACCGAATGCTGATGGTCGTTTTATTATGCCAAGTCCT
GCTAGGAGGCGCGAGCCATGCTAGTTTGATACCTGAGACGGGGAAGAAAA
AAGTCGCCGAGATTCAGGGCCACGCGGGAGGACGCCGCTCAGGGCAGAGC
CATGAGCTCCTGCGGGACTTCGAGGCGACACTTCTGCAGATGTTTGGGCT
GCGCCGCCGCCCGCAGCCTAGCAAGAGTGCCGTCATTCCGGACTACATGC
GGGATCTTTACCGGCTTCAGTCTGGGGAGGAGGAGGAAGAGCAGATCCAC
AGCACTGGTCTTGAGTATCCTGAGCGCCCGGCCAGCCGGGCCAACACCGT
GAGGAGCTTCCACCACGAAGAACATCTGGAGAACATCCCAGGGACCAGTG
AAAACTCTGCTTTTCGTTTCCTCTTTAACCTCAGCAGCATCCCTGAGAAC
GAGGCGATCTCCTCTGCAGAGCTTCGGCTCTTCCGGGAGCAGGTGGACCA
GGGCCCTGATTGGGAAAGGGGCTTCCACCGTATAAACATTTATGAGGTTA
TGAAGCCCCCAGCAGAAGTGGTGCCTGGGCACCTCATCACACGACTACTG
GACACGAGACTGGTCCACCACAATGTGACACGGTGGGAAACTTTTGATGT
GAGCCCTGCGGTCCTTCGCTGGACCCGGGAGAAGCAGCCAAACTATGGGC
TAGCCATTGAGGTGACTCACCTCCATCAGACTCGGACCCACCAGGGCCAG
CATGTCAGGATTAGCCGATCGTTACCTCAAGGGAGTGGGAATTGGGCCCA
GCTCCGGCCCCTCCTGGTCACCTTTGGCCATGATGGCCGGGGCCATGCCT
TGACCCGACGCCGGAGGGCCAAGCGTAGCCCTAAGCATCACTCACAGCGG
GCCAGGAAGAAGAATAAGAACTGCCGGCGCCACTCGCTCTATGTGGACTT
CAGCGATGTGGGCTGGAATGACTGGATTGTGGCCCCACCAGGCTACCAGG
CCTTCTACTGCCATGGGGACTGCCCCTTTCCACTGGCTGACCACCTCAAC
TCAACCAACCATGCCATTGTGCAGACCCTGGTCAATTCTGTCAATTCCAG
TATCCCCAAAGCCTGTTGTGTGCCCACTGAACTGAGTGCCATCTCCATGC
TGTACCTGGATGAGTATGATAAGGTGGTACTGAAAAATTATCAGGAGATG
GTAGTAGAGGGATGTGGGTGCCGCTGCCCAACTTTCTTGTACAAAGTGGT
GGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTG
GAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGA
CCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCC
CTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATT
ACGCTTGA
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQS
HELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIH
STGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPEN
EAISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLL
DTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQ
HVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN
STNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEM
VVEGCGCRCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGG
PAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index