Stock Number Hs1427

Human Gene: NR1D2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NR1D2 nuclear receptor subfamily 1 group D member 2 HGNC:7963 3p24.2 Eip78C 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03825 pGW-HA.attB ENST00000383773.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166201384825

Sequences

DNA sequence (1458 bp) Protein sequence (486 aa)
ATGGAGGTGAATGCAGGAGGTGTGATTGCCTATATCAGTTCTTCCAGCTC
AGCCTCAAGCCCTGCCTCTTGTCACAGTGAGGGTTCTGAGAATAGTTTCC
AGTCCTCCTCCTCTTCTGTTCCATCTTCTCCAAATAGCTCTAATTCTGAT
ACCAATGGTAATCCCAAGAATGGTGATCTCGCCAATATTGAAGGCATCTT
GAAGAATGATCGAATAGATTGTTCTATGAAAACAAGCAAATCGAGTGCAC
CTGGGATGACAAAAAGTCATAGTGGTGTGACAAAATTTAGTGGCATGGTT
CTACTGTGTAAAGTCTGTGGGGATGTGGCGTCAGGATTCCACTATGGAGT
TCATGCTTGCGAAGGCTGTAAGGGTTTCTTTCGGAGAAGTATTCAACAAA
ACATCCAGTACAAGAAGTGCCTGAAGAATGAAAACTGTTCTATAATGAGA
ATGAATAGGAACAGATGTCAGCAATGTCGCTTCAAAAAGTGTCTGTCTGT
TGGAATGTCAAGAGATGCTGTTCGGTTTGGTCGTATTCCTAAGCGTGAAA
AACAGAGGATGCTAATTGAAATGCAAAGTGCAATGAAGACCATGATGAAC
AGCCAGTTCAGTGGTCACTTGCAAAATGACACATTAGTAGAACATCATGA
ACAGACAGCCTTGCCAGCCCAGGAACAGCTGCGACCCAAGCCCCAACTGG
AGCAAGAAAACATCAAAAGCTCTTCTCCTCCATCTTCTGATTTTGCAAAG
GAAGAAGTGATTGGCATGGTGACCAGAGCTCACAAGGATACCTTTATGTA
TAATCAAGAGCAGCAAGAAAACTCAGCTGAGAGCATGCAGCCCCAGAGAG
GAGAACGGATTCCCAAGAACATGGAGCAATATAATTTAAATCATGATCAT
TGCGGCAATGGGCTTAGCAGCCATTTTCCCTGTAGTGAGAGCCAGCAGCA
TCTCAATGGACAGTTCAAAGGGAGGAATATAATGCATTACCCAAATGGTC
ATGCCATTTGTATTGCAAATGGACATTGTATGAACTTCTCCAATGCTTAT
ACTCAAAGAGTATGTGATAGAGTTCCGATAGATGGATTTTCTCAGAATGA
GAACAAGAATAGTTACCTGTGCAACACTGGAGGAAGAATGCATCTGTACA
GTGTTCATATTCAGCCAAAATTTCACCAAAAACAGCAGTACCACACCATT
TCCAGTTTAAACCATGAAGTCCTTTGCCCAACTTTCTTGTACAAAGTGGT
GGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTG
GAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGA
CCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCC
CTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATT
ACGCTTGA
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSD
TNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMV
LLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMR
MNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMN
SQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAK
EEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLYSVHIQPKFHQKQQYHTI
SSLNHEVLCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGG
PAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index