Stock Number Hs1426

Human Gene: HS6ST1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HS6ST1 heparan sulfate 6-O-sulfotransferase 1 HGNC:5201 2q14.3 Hs6st 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03836 pGW-HA.attB ENST00000259241.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166201284824

Sequences

DNA sequence (1467 bp) Protein sequence (489 aa)
ATGCGGCGGCGGCGCGCCGGCGGCAGGACCATGGTTGAGCGCGCCAGCAA
GTTCGTGCTGGTGGTGGCGGGCTCGGTGTGCTTCATGCTCATCTTGTACC
AGTACGCGGGCCCAGGACTGAGCCTGGGCGCGCCCGGCGGCCGCGCGCCG
CCCGACGACCTGGACCTGTTCCCCACGCCCGACCCCCACTACGAGAAGAA
GTACTACTTCCCGGTCCGCGAGCTGGAGCGCTCGCTGCGCTTCGACATGA
AGGGCGACGACGTGATCGTCTTCCTGCACATCCAGAAGACGGGCGGCACC
ACCTTCGGCCGCCACCTCGTGCAGAACGTACGCCTCGAGGTGCCGTGCGA
CTGCCGGCCCGGCCAGAAGAAGTGCACCTGCTACCGGCCCAACCGCCGCG
AGACTTGGCTCTTCTCCCGCTTCTCCACCGGCTGGAGCTGCGGGCTGCAC
GCCGACTGGACCGAGCTCACCAACTGCGTGCCCGGCGTGCTGGACCGCCG
CGACTCCGCCGCGCTGCGCACGCCCAGGAAGTTCTACTACATCACCCTGC
TACGAGACCCCGTGTCCCGCTACCTGAGCGAGTGGCGGCATGTGCAGAGG
GGTGCCACGTGGAAGACGTCGTTGCATATGTGTGATGGGCGCACGCCCAC
GCCTGAGGAGCTGCCGCCCTGCTACGAGGGCACGGACTGGTCGGGCTGCA
CGCTACAGGAGTTCATGGACTGCCCGTACAACCTGGCCAACAACCGCCAG
GTGCGCATGCTGGCCGACCTGAGCCTGGTGGGCTGCTACAACCTGTCCTT
CATCCCCGAGGGCAAGCGGGCCCAGCTGCTGCTCGAGAGCGCCAAGAAGA
ACCTGCGGGGCATGGCCTTCTTCGGCCTGACCGAGTTCCAGCGCAAGACG
CAGTACCTGTTCGAGCGGACGTTCAACCTCAAGTTCATCCGGCCCTTCAT
GCAGTACAATAGCACGCGGGCGGGCGGCGTGGAGGTGGATGAAGACACCA
TCCGGCGCATCGAGGAGCTCAACGACCTGGACATGCAGCTGTACGACTAC
GCCAAGGACCTCTTCCAGCAGCGCTACCAGTACAAGCGGCAGCTGGAGCG
CAGGGAGCAGCGCCTGAGGAGCCGCGAGGAGCGTCTGCTGCACCGGGCCA
AGGAGGCACTGCCGCGGGAGGATGCCGACGAGCCGGGCCGCGTGCCCACC
GAGGACTACATGAGCCACATCATTGAGAAGTGGTTGCCAACTTTCTTGTA
CAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTT
CCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGA
GCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTTGA
MRRRRAGGRTMVERASKFVLVVAGSVCFMLILYQYAGPGLSLGAPGGRAP
PDDLDLFPTPDPHYEKKYYFPVRELERSLRFDMKGDDVIVFLHIQKTGGT
TFGRHLVQNVRLEVPCDCRPGQKKCTCYRPNRRETWLFSRFSTGWSCGLH
ADWTELTNCVPGVLDRRDSAALRTPRKFYYITLLRDPVSRYLSEWRHVQR
GATWKTSLHMCDGRTPTPEELPPCYEGTDWSGCTLQEFMDCPYNLANNRQ
VRMLADLSLVGCYNLSFIPEGKRAQLLLESAKKNLRGMAFFGLTEFQRKT
QYLFERTFNLKFIRPFMQYNSTRAGGVEVDEDTIRRIEELNDLDMQLYDY
AKDLFQQRYQYKRQLERREQRLRSREERLLHRAKEALPREDADEPGRVPT
EDYMSHIIEKWLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGG
AGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index