Stock Number Hs1425

Human Gene: CCNE1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CCNE1 cyclin E1 HGNC:1589 19q12 CycE 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03835 pGW-HA.attB ENST00000575243.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK331662011

Sequences

DNA sequence (1464 bp) Protein sequence (488 aa)
ATGCCGAGGGAGCGCAGGGAGCGGGATGCGAAGGAGCGGGACACCATGAA
GGAGGACGGCGGCGCGGAGTTCTCGGCTCGCTCCAGGAAGAGGAAGGCAA
ACGTGACCGTTTTTTTGCAGGATCCAGATGAAGAAATGGCCAAAATCGAC
AGGACGGCGAGGGACCAGTGTGGGAGCCAGCCTTGGGACAATAATGCAGT
CTGTGCAGACCCCTGCTCCCTGATCCCCACACCTGACAAAGAAGATGATG
ACCGGGTTTACCCAAACTCAACGTGCAAGCCTCGGATTATTGCACCATCC
AGAGGCTCCCCGCTGCCTGTACTGAGCTGGGCAAATAGAGAGGAAGTCTG
GAAAATCATGTTAAACAAGGAAAAGACATACTTAAGGGATCAGCACTTTC
TTGAGCAACACCCTCTTCTGCAGCCAAAAATGCGAGCAATTCTTCTGGAT
TGGTTAATGGAGGTGTGTGAAGTCTATAAACTTCACAGGGAGACCTTTTA
CTTGGCACAAGATTTCTTTGACCGGTATATGGCGACACAAGAAAATGTTG
TAAAAACTCTTTTACAGCTTATTGGGATTTCATCTTTATTTATTGCAGCC
AAACTTGAGGAAATCTATCCTCCAAAGTTGCACCAGTTTGCGTATGTGAC
AGATGGAGCTTGTTCAGGAGATGAAATTCTCACCATGGAATTAATGATTA
TGAAGGCCCTTAAGTGGCGTTTAAGTCCCCTGACTATTGTGTCCTGGCTG
AATGTATACATGCAGGTTGCATATCTAAATGACTTACATGAAGTGCTACT
GCCGCAGTATCCCCAGCAAATCTTTATACAGATTGCAGAGCTGTTGGATC
TCTGTGTCCTGGATGTTGACTGCCTTGAATTTCCTTATGGTATACTTGCT
GCTTCGGCCTTGTATCATTTCTCGTCATCTGAATTGATGCAAAAGGTTTC
AGGGTATCAGTGGTGCGACATAGAGAACTGTGTCAAGTGGATGGTTCCAT
TTGCCATGGTTATAAGGGAGACGGGGAGCTCAAAACTGAAGCACTTCAGG
GGCGTCGCTGATGAAGATGCACACAACATACAGACCCACAGAGACAGCTT
GGATTTGCTGGACAAAGCCCGAGCAAAGAAAGCCATGTTGTCTGAACAAA
ATAGGGCTTCTCCTCTCCCCAGTGGGCTCCTCACCCCGCCACAGAGCGGT
AAGAAGCAGAGCAGCGGGCCGGAAATGGCGTGCCCAACTTTCTTGTACAA
AGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCA
TCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCC
GGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGG
CTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTC
CAGATTACGCTTGA
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKID
RTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPS
RGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLD
WLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAA
KLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWL
NVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFR
GVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG
KKQSSGPEMACPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGA
GGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index