Stock Number Hs1424

Human Gene: NIPAL1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NIPAL1 NIPA like domain containing 1 HGNC:27194 4p12 spict 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03834 pGW-HA.attB ENST00000295461.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166201084823

Sequences

DNA sequence (1464 bp) Protein sequence (488 aa)
ATGGGGGCACAGGTGAGGCTGCCGCCCGGAGAGCCCTGCCGAGAAGGATA
TGTGCTGTCTCTGGTCTGTCCAAACTCCTCCCAGGCTTGGTGTGAGATCA
CAAATGTGTCACAGCTGCTGGCTTCTCCTGTGCTCTACACGGACCTGAAT
TACAGCATAAACAACTTGAGCATTTCAGCAAATGTAGAAAACAAATACAG
TCTTTATGTGGGCTTGGTACTGGCAGTAAGCTCAAGTATTTTTATTGGCT
CCAGCTTCATACTGAAAAAGAAGGGCCTCTTGCAACTGGCCAGCAAGGGC
TTTACTAGAGCTGGACAAGGTGGACATTCTTACCTGAAGGAATGGCTCTG
GTGGGTAGGATTGCTGTCAATGGGAGCAGGAGAGGCTGCAAATTTTGCTG
CTTATGCTTTTGCACCTGCCACCTTGGTCACCCCTCTGGGTGCTTTGAGT
GTTCTCATAAGTGCAATATTATCTTCCTACTTTTTAAACGAGCACTTGAA
CATTCATGGGAAAATAGGCTGCATATTAAGTATATTGGGGTCAACTGTGA
TGGTTATCCATGCCCCACAAGAAGAGGAAGTCACATCTTTGCATGAAATG
GAAATGAAATTGAGAGACCCAGGGTTTATTTCCTTTGCTGTGATCATAAC
TGTGATCTCCTTGGTGCTGATTTTGATTGTGGCTCCCAAGAAAGGACAGA
CCAATATATTGGTTTATATTTCAATCTGTTCCTTGATTGGAGCGTTTTCA
GTTTCTTCTGTGAAAGGCCTGGGAATTGCCATTAAGGAGCTGATAGAATG
GAAGCCAGTTTACAAACATCCGCTGGTCTTTGTTTTGCTGGCTGTACTTG
TGCTTTCAGTAACTACACAGATTAACTATCTCAACAAGGCACTGGACACC
TTTAATACCTCTCTTGTGACACCAATTTATTATGTATTCTTCACATCCAT
GGTAGTGACTTGCTCTGCCATCTTATTCCAAGAGTGGTATGGCATGACAG
CTGGAGATATCATTGGGACCCTGAGTGGATTCTTCACTATTATCATTGGC
ATCTTCCTTCTACATGCTTTTAAAAATACTGACATTACTTGGAGTGAGCT
TACATCCACTGCTAAGAAAGAAGCCGTCTCTCTGAATGTCAATGAAAACA
ATTATGTTTTACTAGAGAACTTGGAGTGTTCAGCCCCAGGATACAATGAT
GACGTTACCTTGTTTAGTAGAACTGATGACTTGCCAACTTTCTTGTACAA
AGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCA
TCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCC
GGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGG
CTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTC
CAGATTACGCTTGA
MGAQVRLPPGEPCREGYVLSLVCPNSSQAWCEITNVSQLLASPVLYTDLN
YSINNLSISANVENKYSLYVGLVLAVSSSIFIGSSFILKKKGLLQLASKG
FTRAGQGGHSYLKEWLWWVGLLSMGAGEAANFAAYAFAPATLVTPLGALS
VLISAILSSYFLNEHLNIHGKIGCILSILGSTVMVIHAPQEEEVTSLHEM
EMKLRDPGFISFAVIITVISLVLILIVAPKKGQTNILVYISICSLIGAFS
VSSVKGLGIAIKELIEWKPVYKHPLVFVLLAVLVLSVTTQINYLNKALDT
FNTSLVTPIYYVFFTSMVVTCSAILFQEWYGMTAGDIIGTLSGFFTIIIG
IFLLHAFKNTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYND
DVTLFSRTDDLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGA
GGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index