Stock Number Hs1422

Human Gene: RBMS2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RBMS2 RNA binding motif single stranded interacting protein 2 HGNC:9909 12q13.3 shep 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03820 pGW-HA.attB ENST00000262031.9 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166200884822

Sequences

DNA sequence (1455 bp) Protein sequence (485 aa)
ATGCTGCTATCCGTGACTTCCAGGCCCGGGATTTCGACTTTTGGCTACAA
TAGAAACAACAAGAAGCCATATGTGTCACTGGCTCAGCAGATGGCACCAC
CTAGCCCAAGCAACAGTACACCTAACAGCAGTAGTGGAAGCAATGGAAAT
GACCAGCTGAGCAAAACCAACCTATACATCCGAGGATTGCAACCAGGCAC
TACTGACCAAGATCTTGTCAAGCTGTGTCAGCCATATGGCAAGATTGTTT
CCACTAAGGCCATACTGGACAAGACCACAAACAAATGTAAAGGCTATGGC
TTTGTAGATTTTGACAGCCCTTCAGCAGCACAGAAAGCTGTAACAGCACT
GAAGGCCAGCGGTGTACAGGCACAGATGGCAAAGCAACAGGAACAGGACC
CCACAAATTTATACATCTCAAACCTCCCACTGTCAATGGATGAGCAGGAA
CTGGAGGGGATGCTGAAGCCCTTTGGCCAGGTTATCTCCACCCGTATCCT
TCGAGATACCAGTGGGACCAGCAGAGGTGTTGGCTTTGCAAGGATGGAGT
CCACAGAGAAGTGTGAAGCCATCATCACCCACTTTAATGGAAAATATATT
AAGACACCCCCTGGAGTACCAGCCCCATCCGATCCCTTGCTTTGCAAATT
TGCTGATGGCGGGCCAAAGAAACGACAGAACCAAGGAAAATTTGTGCAAA
ATGGACGGGCTTGGCCAAGGAATGCAGACATGGGCGTCATGGCCTTGACC
TATGACCCCACCACAGCTCTTCAGAATGGGTTTTACCCAGCCCCCTATAA
CATCACCCCCAACAGGATGCTTGCTCAGTCTGCACTCTCCCCATACCTTT
CCTCTCCTGTGTCTTCGTATCAGAGAGTGACTCAGACATCTCCTCTACAA
GTACCTAACCCATCCTGGATGCACCACCATTCATACCTCATGCAGCCTTC
AGGTTCAGTTCTGACACCAGGGATGGACCATCCCATTTCTCTCCAGCCTG
CCTCCATGATGGGACCCCTTACCCAGCAACTGGGCCATCTCTCCCTCAGC
AGCACAGGCACGTATATGCCGACGGCTGCAGCTATGCAAGGAGCTTACAT
CTCCCAGTACACCCCTGTGCCTTCTTCCAGTGTTTCAGTCGAGGAGAGCA
GCGGCCAACAGAACCAAGTGGCAGTGGACGCACCCTCAGAGCATGGGGTC
TATTCTTTCCAGTTCAACAAGTACCCAACTTTCTTGTACAAAGTGGTGGT
ACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAG
CTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCT
GCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTA
TGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACG
CTTGA
MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN
DQLSKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYG
FVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQE
LEGMLKPFGQVISTRILRDTSGTSRGVGFARMESTEKCEAIITHFNGKYI
KTPPGVPAPSDPLLCKFADGGPKKRQNQGKFVQNGRAWPRNADMGVMALT
YDPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQ
VPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLS
STGTYMPTAAAMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGV
YSFQFNKYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGP
AGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index