Stock Number Hs1421

Human Gene: GAPDHS


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
GAPDHS glyceraldehyde-3-phosphate dehydrogenase, spermatogenic HGNC:24864 19q13.12 Gapdh1 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03819 pGW-HA.attB ENST00000222286.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166200784821

Sequences

DNA sequence (1461 bp) Protein sequence (487 aa)
ATGTCGAAGCGCGACATCGTCCTCACCAATGTCACCGTTGTCCAGTTGCT
GCGACAGCCGTGCCCGGTGACCAGAGCACCGCCCCCACCTGAGCCTAAGG
CTGAAGTAGAGCCCCAGCCACAACCAGAGCCCACACCAGTCAGGGAGGAA
ATAAAGCCACCACCGCCACCACTGCCTCCTCACCCCGCTACTCCTCCTCC
TAAGATGGTGTCTGTGGCCCGGGAGCTGACTGTGGGCATCAATGGATTTG
GACGCATCGGTCGCCTGGTCCTGCGCGCCTGCATGGAGAAGGGTGTTAAG
GTGGTGGCTGTGAATGATCCATTCATTGACCCGGAATACATGGTGTACAT
GTTTAAGTATGACTCCACCCACGGCCGATACAAGGGAAGTGTGGAATTCA
GGAATGGACAACTGGTCGTGGACAACCATGAGATCTCTGTCTACCAGTGC
AAAGAGCCCAAACAGATCCCCTGGAGGGCTGTCGGGAGCCCCTACGTGGT
GGAGTCCACAGGCGTGTACCTCTCCATACAGGCAGCTTCGGACCACATCT
CTGCAGGTGCTCAACGTGTGGTCATCTCCGCGCCCTCACCGGATGCACCA
ATGTTCGTCATGGGTGTCAATGAAAATGACTATAACCCTGGCTCCATGAA
CATTGTGAGCAACGCGTCCTGCACCACCAACTGTTTGGCTCCCCTCGCCA
AAGTCATCCACGAGCGATTTGGGATCGTGGAAGGGTTGATGACCACAGTC
CATTCCTACACGGCCACCCAGAAGACAGTGGACGGGCCATCAAGGAAGGC
CTGGCGAGATGGGCGGGGTGCCCACCAGAACATCATCCCAGCCTCCACTG
GGGCTGCGAAAGCTGTGACCAAAGTCATCCCAGAGCTCAAAGGGAAGCTG
ACAGGGATGGCGTTCCGGGTACCAACCCCGGATGTGTCTGTCGTGGACCT
GACCTGCCGCCTCGCCCAGCCTGCCCCCTACTCAGCCATCAAGGAGGCTG
TAAAAGCAGCAGCCAAGGGGCCCATGGCTGGCATCCTTGCCTACACCGAG
GATGAGGTCGTCTCTACGGACTTCCTCGGTGATACCCACTCGTCCATCTT
CGATGCTAAGGCCGGCATTGCGCTCAATGACAATTTCGTGAAGCTCATTT
CATGGTACGACAACGAATATGGCTACAGTCACCGGGTGGTCGACCTCCTC
CGCTACATGTTCAGCCGAGACAAGTTGGACCCAGCTTTCTTGTACAAAGT
GGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCC
TTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGT
GGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTA
TCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAG
ATTACGCTTGA
MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREE
IKPPPPPLPPHPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVK
VVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQC
KEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAP
MFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTV
HSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL
TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE
DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLL
RYMFSRDKLDPAFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAG
GPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index