Stock Number Hs1420

Human Gene: HERPUD2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HERPUD2 HERPUD family member 2 HGNC:21915 7p14.2 Herp 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03817 pGW-HA.attB ENST00000603731.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166200684820

Sequences

DNA sequence (1452 bp) Protein sequence (484 aa)
ATGGACCAAAGTGGGATGGAGATTCCTGTGACCCTCATCATTAAAGCACC
GAATCAGAAATACAGTGACCAGACTATTAGCTGCTTCTTGAACTGGACCG
TGGGGAAACTAAAAACGCATCTATCTAACGTTTACCCTAGCAAACCATTG
ACGAAGGATCAGAGATTGGTGTATTCGGGCAGACTGCTTCCCGATCATCT
GCAGCTGAAAGACATTCTCAGAAAACAAGATGAGTATCATATGGTTCATC
TAGTATGTACTTCTCGGACTCCTCCCAGTTCTCCAAAATCCAGCACCAAT
AGAGAAAGTCATGAAGCATTGACATCCAGCAGCAATTCTAGTTCAGATCA
TTCAGGATCAACAACTCCATCATCTGGTCAAGAAACCTTGTCTTTAGCTG
TGGGTTCTTCCTCAGAAGGATTGAGGCAGCGTACCCTTCCACAAGCACAA
ACTGACCAAGCACAGAGTCACCAGTTTCCATATGTAATGCAAGGAAATGT
AGACAACCAATTTCCTGGGCAAGCTGCTCCACCTGGATTCCCAGTGTATC
CCGCGTTTAGCCCACTGCAGATGCTATGGTGGCAACAGATGTATGCTCAT
CAGTATTATATGCAGTATCAAGCTGCAGTTTCAGCTCAGGCCACATCAAA
TGTCAACCCAACCCAGCCTACTACTTCACAGCCTCTAAATTTGGCACATG
TTCCTGGAGAAGAACCCCCACCAGCTCCAAACCTAGTGGCCCAAGAAAAT
CGACCCATGAATGAGAATGTTCAAATGAATGCACAGGGAGGTCCAGTACT
AAATGAAGAAGACTTCAATCGAGACTGGCTAGACTGGATGTACACGTTCT
CACGAGCTGCGATTCTCCTTAGCATTGTATACTTCTATTCTTCTTTTAGT
CGGTTTATCATGGTAATGGGAGCCATGCTACTGGTTTATTTACACCAAGC
TGGATGGTTTCCTTTTAGGCAAGAAGGAGGTCATCAGCAGGCTCCCAACA
ATAATGCCGAAGTTAACAATGATGGGCAAAATGCAAACAACTTGGAACTT
GAAGAAATGGAGCGTCTTATGGATGATGGGCTTGAAGATGAGAGTGGAGA
AGATGGAGGTGAAGATGCCAGTGCAATTCAAAGGCCTGGATTAATGGCTT
CAGCTTGGTCTTTCATCACCACCTTCTTTACTTCACTAATACCAGAGGGG
CCTCCCCAGGTTGCCAATTGCCCAACTTTCTTGTACAAAGTGGTGGTACC
TCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTC
CTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCG
GGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGA
CGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTT
GA
MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL
TKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTN
RESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQ
TDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH
QYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQEN
RPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFS
RFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLEL
EEMERLMDDGLEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEG
PPQVANCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPA
GLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index