Stock Number Hs1418

Human Gene: SERBP1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SERBP1 SERPINE1 mRNA binding protein 1 HGNC:17860 1p31.3 vig 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03824 pGW-HA.attB ENST00000370995.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166200484819

Sequences

DNA sequence (1458 bp) Protein sequence (486 aa)
ATGCCTGGGCACTTACAGGAAGGCTTCGGCTGCGTGGTCACCAACCGATT
CGACCAGTTATTTGACGACGAATCGGACCCCTTCGAGGTGCTGAAGGCAG
CAGAGAACAAGAAAAAAGAAGCCGGCGGGGGCGGCGTTGGGGGCCCTGGG
GCCAAGAGCGCAGCTCAGGCCGCGGCCCAGACCAACTCCAACGCGGCAGG
CAAACAGCTGCGCAAGGAGTCCCAGAAAGACCGCAAGAACCCGCTGCCCC
CCAGCGTTGGCGTGGTTGACAAGAAAGAGGAGACGCAGCCGCCCGTGGCG
CTTAAGAAAGAAGGAATAAGACGAGTTGGAAGAAGACCTGATCAACAACT
TCAGGGTGAAGGGAAAATAATTGATAGAAGACCAGAAAGGCGACCACCTC
GTGAACGAAGATTCGAAAAGCCACTTGAAGAAAAGGGTGAAGGAGGCGAA
TTTTCAGTTGATAGACCGATTATTGACCGACCTATTCGAGGTCGTGGTGG
TCTTGGAAGAGGTCGAGGGGGCCGTGGACGTGGAATGGGCCGAGGAGATG
GATTTGATTCTCGTGGCAAACGTGAATTTGATAGGCATAGTGGAAGTGAT
AGATCTTCTTTTTCACATTACAGTGGCCTGAAGCACGAGGACAAACGTGG
AGGTAGCGGATCTCACAACTGGGGAACTGTCAAAGACGAATTAACAGAGT
CCCCCAAATACATTCAGAAACAAATATCTTATAATTACAGTGACTTGGAT
CAATCAAATGTGACTGAGGAAACACCTGAAGGTGAAGAACATCATCCAGT
GGCAGACACTGAAAATAAGGAGAATGAAGTTGAAGAGGTAAAAGAGGAGG
GTCCAAAAGAGATGACTTTGGATGAGTGGAAGGCTATTCAAAATAAGGAC
CGGGCAAAAGTAGAATTTAATATCCGAAAACCAAATGAAGGTGCTGATGG
GCAGTGGAAGAAGGGATTTGTTCTTCATAAATCAAAGAGTGAAGAGGCTC
ATGCTGAAGATTCGGTTATGGACCATCATTTCCGGAAGCCAGCAAATGAT
ATAACGTCTCAGCTGGAGATCAATTTTGGAGACCTTGGCCGCCCAGGACG
TGGCGGCAGGGGAGGACGAGGTGGACGTGGGCGTGGTGGGCGCCCAAACC
GTGGCAGCAGGACCGACAAGTCAAGTGCTTCTGCTCCTGATGTGGATGAC
CCAGAGGCATTCCCAGCTCTGGCTTACCCAACTTTCTTGTACAAAGTGGT
GGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTG
GAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGA
CCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCC
CTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATT
ACGCTTGA
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPG
AKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVA
LKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGE
FSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSD
RSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLD
QSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKD
RAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND
ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDD
PEAFPALAYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGG
PAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index