Stock Number Hs1417

Human Gene: SERPINI2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SERPINI2 serpin family I member 2 HGNC:8945 3q26.1 Spn42Da 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03808 pGW-HA.attB ENST00000461846.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166200384818

Sequences

DNA sequence (1449 bp) Protein sequence (483 aa)
ATGGACACAATCTTCTTGTGGAGTCTTCTATTGCTGTTTTTTGGAAGTCA
AGCCTCAAGATGCTCAGCTCAAAAAAATACCGAATTTGCAGTGGATCTTT
ATCAAGAGGTTTCCTTATCTCATAAGGACAACATTATATTTTCACCCCTT
GGAATAACTTTGGTTCTTGAGATGGTACAACTGGGAGCCAAAGGAAAAGC
ACAGCAGCAGATAAGACAAACTTTAAAACAACAGGAAACCTCAGCTGGGG
AAGAATTTTTTGTACTGAAGTCATTTTTCTCTGCCATCTCAGAGAAAAAA
CAAGAATTTACATTTAATCTTGCCAATGCCCTCTACCTTCAAGAAGGATT
CACTGTGAAAGAACAGTATCTCCATGGCAACAAGGAATTTTTTCAGAGTG
CTATAAAACTGGTGGATTTTCAAGATGCAAAGGCTTGTGCAGAGATGATA
AGTACCTGGGTAGAAAGAAAAACAGATGGAAAAATTAAAGACATGTTTTC
AGGGGAAGAATTTGGCCCTCTGACTCGGCTTGTCCTGGTGAATGCTATTT
ATTTCAAAGGAGATTGGAAACAGAAATTCAGAAAAGAGGACACACAGCTG
ATAAATTTTACTAAGAAAAATGGTTCAACTGTCAAAATTCCAATGATGAA
GGCTCTTCTGAGAACAAAATATGGTTATTTTTCTGAATCTTCCCTGAACT
ACCAAGTTTTAGAATTGTCTTACAAAGGTGATGAATTTAGCTTAATTATC
ATACTTCCTGCAGAAGGTATGGATATAGAAGAAGTGGAAAAACTAATTAC
TGCTCAACAAATCCTAAAATGGCTCTCTGAGATGCAAGAAGAGGAAGTAG
AAATAAGCCTCCCTAGATTTAAAGTAGAACAAAAAGTAGACTTCAAAGAC
GTTTTGTATTCTTTGAACATAACCGAGATATTTAGTGGTGGCTGCGACCT
TTCTGGAATAACAGATTCATCTGAAGTGTATGTTTCCCAAGTGACGCAAA
AAGTTTTCTTTGAGATAAATGAAGATGGTAGTGAAGCTGCAACATCAACT
GGCATACACATCCCTGTGATCATGAGTCTGGCTCAAAGCCAATTTATAGC
AAATCATCCATTTCTGTTTATTATGAAGCATAATCCAACAGAATCAATTC
TGTTTATGGGAAGAGTGACAAATCCTGACACCCAGGAGATAAAAGGAAGA
GATTTAGATTCACTGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCG
AAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTT
CAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGG
TTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGT
CCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MDTIFLWSLLLLFFGSQASRCSAQKNTEFAVDLYQEVSLSHKDNIIFSPL
GITLVLEMVQLGAKGKAQQQIRQTLKQQETSAGEEFFVLKSFFSAISEKK
QEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQDAKACAEMI
STWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTQL
INFTKKNGSTVKIPMMKALLRTKYGYFSESSLNYQVLELSYKGDEFSLII
ILPAEGMDIEEVEKLITAQQILKWLSEMQEEEVEISLPRFKVEQKVDFKD
VLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFFEINEDGSEAATST
GIHIPVIMSLAQSQFIANHPFLFIMKHNPTESILFMGRVTNPDTQEIKGR
DLDSLCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAG
LIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index