Stock Number Hs1416

Human Gene: HERPUD1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
HERPUD1 homocysteine inducible ER protein with ubiquitin like domain 1 HGNC:13744 16q13 Herp 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03744 pGW-HA.attB ENST00000439977.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166200284817

Sequences

DNA sequence (1407 bp) Protein sequence (469 aa)
ATGGAGTCCGAGACCGAACCCGAGCCCGTCACGCTCCTGGTGAAGAGCCC
CAACCAGCGCCACCGCGACTTGGAGCTGAGTGGCGACCGCGGCTGGAGTG
TGGGCCACCTCAAGGCCCACCTGAGCCGCGTCTACCCCGAGCGTCCGCGT
CCAGAGGACCAGAGGTTAATTTATTCTGGGAAGCTGTTGTTGGATCACCA
ATGTCTCAGGGACTTGCTTCCAAAGCAGGAAAAACGGCATGTTTTGCATC
TGGTGTGCAATGTGAAGAGTCCTTCAAAAATGCCAGAAATCAACGCCAAG
GTGGCTGAATCCACAGAGGAGCCTGCTGGTTCTAATCGGGGACAGTATCC
TGAGGATTCCTCAAGTGATGGTTTAAGGCAAAGGGAAGTTCTTCGGAACC
TTTCTTCCCCTGGATGGGAAAACATCTCAAGGCCTGAAGCTGCCCAGCAG
GCATTCCAAGGCCTGGGTCCTGGTTTCTCCGGTTACACACCCTATGGGTG
GCTTCAGCTTTCCTGGTTCCAGCAGATATATGCACGACAGTACTACATGC
AATATTTAGCAGCCACTGCTGCATCAGGGGCTTTTGTTCCACCACCAAGT
GCACAAGAGATACCTGTGGTCTCTGCACCTGCTCCAGCCCCTATTCACAA
CCAGTTTCCAGCTGAAAACCAGCCTGCCAATCAGAATGCTGCTCCTCAAG
TGGTTGTTAATCCTGGAGCCAATCAAAATTTGCGGATGAATGCACAAGGT
GGCCCTATTGTGGAAGAAGATGATGAAATAAATCGAGATTGGTTGGATTG
GACCTATTCAGCAGCTACATTTTCTGTTTTTCTCAGTATCCTCTACTTCT
ACTCCTCCCTGAGCAGATTCCTCATGGTCATGGGGGCCACCGTTGTTATG
TACCTGCATCACGTTGGGTGGTTTCCATTTAGACCGAGGCCGGTTCAGAA
CTTCCCAAATGATGGTCCTCCTCCTGACGTTGTAAATCAGGACCCCAACA
ATAACTTACAGGAAGGCACTGATCCTGAAACTGAAGACCCCAACCACCTC
CCTCCAGACAGGGATGTACTAGATGGCGAGCAGACCAGCCCCTCCTTTAT
GAGCACAGCATGGCTTGTCTTCAAGACTTTCTTTGCCTCTCTTCTTCCAG
AAGGCCCCCCAGCCATCGCAAACTGCCCAACTTTCTTGTACAAAGTGGTG
GTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGG
AGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGAC
CTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCC
TATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTA
CGCTTGA
MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPR
PEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAK
VAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQ
AFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPS
AQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQG
GPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM
YLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHL
PPDRDVLDGEQTSPSFMSTAWLVFKTFFASLLPEGPPAIANCPTFLYKVV
VPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYP
YDVPDYAGSYPYDVPDYA*

Index