Stock Number Hs1415

Human Gene: ARRB2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ARRB2 arrestin beta 2 HGNC:712 17p13.2 krz 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03928 pGW-HA.attB ENST00000269260.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166200184816

Sequences

DNA sequence (1461 bp) Protein sequence (487 aa)
ATGGGGGAGAAACCCGGGACCAGGGTCTTCAAGAAGTCGAGCCCTAACTG
CAAGCTCACCGTGTACTTGGGCAAGCGGGACTTCGTAGATCACCTGGACA
AAGTGGACCCTGTAGATGGCGTGGTGCTTGTGGACCCTGACTACCTGAAG
GACCGCAAAGTGTTTGTGACCCTCACCTGCGCCTTCCGCTATGGCCGTGA
AGACCTGGATGTGCTGGGCTTGTCCTTCCGCAAAGACCTGTTCATCGCCA
CCTACCAGGCCTTCCCCCCGGTGCCCAACCCACCCCGGCCCCCCACCCGC
CTGCAGGACCGGCTGCTGAGGAAGCTGGGCCAGCATGCCCACCCCTTCTT
CTTCACCATACCCCAGAATCTTCCATGCTCCGTCACACTGCAGCCAGGCC
CAGAGGATACAGGAAAGGCCTGCGGCGTAGACTTTGAGATTCGAGCCTTC
TGTGCTAAATCACTAGAAGAGAAAAGCCACAAAAGGAACTCTGTGCGGCT
GGTGATCCGAAAGGTGCAGTTCGCCCCGGAGAAACCCGGCCCCCAGCCTT
CAGCCGAAACCACACGCCACTTCCTCATGTCTGACCGGTCCCTGCACCTC
GAGGCTTCCCTGGACAAGGAGCTGTACTACCATGGGGAGCCCCTCAATGT
AAATGTCCACGTCACCAACAACTCCACCAAGACCGTCAAGAAGATCAAAG
TCTCTGTGAGACAGTACGCCGACATCTGCCTCTTCAGCACCGCCCAGTAC
AAGTGTCCTGTGGCTCAACTCGAACAAGATGACCAGGTATCTCCCAGCTC
CACATTCTGTAAGGTGTACACCATAACCCCACTGCTCAGTGACAACCGGG
AGAAGCGGGGTCTCGCCCTGGATGGGAAACTCAAGCACGAGGACACCAAC
CTGGCTTCCAGCACCATCGTGAAGGAGGGTGCCAACAAGGAGGTGCTGGG
AATCCTGGTGTCCTACAGGGTCAAGGTGAAGCTGGTGGTGTCTCGAGGCG
GGGATGTCTCTGTGGAGCTGCCTTTTGTTCTTATGCACCCCAAGCCCCAC
GACCACATCCCCCTCCCCAGACCCCAGTCAGCCGCTCCGGAGACAGATGT
CCCTGTGGACACCAACCTCATTGAATTTGATACCAACTATGCCACAGATG
ATGACATTGTGTTTGAGGACTTTGCCCGGCTTCGGCTGAAGGGGATGAAG
GATGACGACTATGATGATCAACTCTGCTACCCAACTTTCTTGTACAAAGT
GGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCC
TTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGT
GGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTA
TCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAG
ATTACGCTTGA
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLK
DRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTR
LQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAF
CAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHL
EASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQY
KCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPH
DHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMK
DDDYDDQLCYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAG
GPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index