Stock Number Hs1413

Human Gene: POC1A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
POC1A POC1 centriolar protein A HGNC:24488 3p21.2 Poc1 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03923 pGW-HA.attB ENST00000296484.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166199984815

Sequences

DNA sequence (1455 bp) Protein sequence (485 aa)
ATGGCTGCGCCCTGCGCGGAGGACCCCTCGCTGGAAAGGCATTTTAAGGG
CCACCGAGATGCAGTTACCTGTGTGGACTTCAGTATCAACACAAAGCAGC
TGGCCAGTGGCTCCATGGACTCATGCCTCATGGTCTGGCACATGAAGCCG
CAGTCACGCGCCTACCGCTTCACTGGCCACAAGGATGCCGTCACCTGTGT
GAACTTCTCTCCTTCGGGACACCTGCTTGCTTCCGGCTCCCGAGACAAGA
CTGTCCGCATCTGGGTACCCAATGTCAAAGGTGAGTCCACTGTGTTTCGT
GCACACACAGCCACAGTGAGGAGTGTCCACTTCTGCAGTGATGGCCAGTC
CTTCGTGACAGCCTCTGACGACAAGACAGTCAAAGTGTGGGCAACTCATC
GCCAGAAATTCCTGTTCTCCCTGAGCCAGCATATCAACTGGGTCCGCTGT
GCCAAGTTCTCCCCCGACGGGCGGCTCATCGTGTCTGCCAGTGATGACAA
GACTGTTAAGCTGTGGGACAAGAGCAGCCGGGAATGTGTCCACTCGTATT
GTGAGCATGGCGGCTTTGTCACCTATGTGGACTTCCACCCCAGTGGGACG
TGCATTGCCGCTGCCGGCATGGACAACACAGTGAAGGTGTGGGACGTGCG
GACTCACCGGCTGCTGCAGCATTATCAGTTGCACAGTGCAGCAGTGAACG
GGCTCTCTTTCCACCCGTCGGGAAACTACCTGATCACAGCCTCCAGTGAC
TCAACCCTGAAGATCCTGGACCTGATGGAGGGCCGGCTGCTCTACACACT
CCACGGGCATCAGGGACCAGCCACCACTGTTGCCTTTTCAAGAACGGGGG
AGTATTTTGCTTCTGGAGGCTCTGATGAACAAGTGATGGTTTGGAAGAGT
AACTTTGATATTGTTGATCATGGAGAAGTCACGAAAGTGCCGAGGCCCCC
AGCCACACTGGCCAGCTCCATGGGGAATCTGCCAGAAGTGGACTTCCCTG
TCCCCCCAGGCAGAGGCAGGAGTGTGGAGTCTGTGCAGAGCCAGCCCCAG
GAGCCCGTGAGTGTGCCCCAGACACTGACTAGCACGCTGGAGCACATTGT
GGGCCAGCTGGATGTCCTCACTCAGACAGTCTCCATTCTGGAGCAGCGGT
TGACACTGACAGAAGACAAGCTGAAGCAGTGTCTGGAGAACCAGCAGCTA
ATCATGCAGAGAGCAACACCATTGCCAACTTTCTTGTACAAAGTGGTGGT
ACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAG
CTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCT
GCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTA
TGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACG
CTTGA
MAAPCAEDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKP
QSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFR
AHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRC
AKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGT
CIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSD
STLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS
NFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQ
EPVSVPQTLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQCLENQQL
IMQRATPLPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGP
AGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index