Stock Number Hs1412

Human Gene: MAGEB6


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
MAGEB6 MAGE family member B6 HGNC:23796 Xp21.3 MAGE 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03922 pGW-HA.attB ENST00000379034.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166199884814

Sequences

DNA sequence (1455 bp) Protein sequence (485 aa)
ATGCCTCGGGGTCACAAGAGTAAGCTCCGTACCTGTGAGAAACGCCAAGA
GACCAATGGTCAGCCACAGGGTCTCACGGGTCCCCAGGCCACTGCAGAGA
AGCAGGAAGAGTCCCACTCTTCCTCATCCTCTTCTCGCGCTTGTCTGGGT
GATTGTCGTAGGTCTTCTGATGCCTCCATTCCTCAGGAGTCTCAGGGAGT
GTCACCCACTGGGTCTCCTGATGCAGTTGTTTCATATTCAAAATCCGATG
TGGCTGCCAACGGCCAAGATGAGAAAAGTCCAAGCACCTCCCGTGATGCC
TCCGTTCCTCAGGAGTCTCAGGGAGCTTCACCCACTGGCTCTCCTGATGC
AGGTGTTTCAGGCTCAAAATATGATGTGGCTGCCAACGGCCAAGATGAGA
AAAGTCCAAGCACTTCCCATGATGTCTCCGTTCCTCAGGAGTCTCAGGGA
GCTTCACCCACTGGCTCGCCTGATGCAGGTGTTTCAGGCTCAAAATATGA
TGTGGCTGCCGAGGGTGAAGATGAGGAAAGTGTAAGCGCCTCACAGAAAG
CCATCATTTTTAAGCGCTTAAGCAAAGATGCTGTAAAGAAGAAGGCGTGC
ACGTTGGCGCAATTCCTGCAGAAGAAGTTTGAGAAGAAAGAGTCCATTTT
GAAGGCAGACATGCTGAAGTGTGTCCGCAGAGAGTACAAGCCCTACTTCC
CTCAGATCCTCAACAGAACCTCCCAACATTTGGTGGTGGCCTTTGGCGTT
GAATTGAAAGAAATGGATTCCAGCGGCGAGTCCTACACCCTTGTCAGCAA
GCTAGGCCTCCCCAGTGAAGGAATTCTGAGTGGTGATAATGCGCTGCCGA
AGTCGGGTCTCCTGATGTCGCTCCTGGTTGTGATCTTCATGAACGGCAAC
TGTGCCACTGAAGAGGAGGTCTGGGAGTTCCTGGGTCTGTTGGGGATATA
TGATGGGATCCTGCATTCAATCTATGGGGATGCTCGGAAGATCATTACTG
AAGATTTGGTGCAAGATAAGTACGTGGTTTACCGGCAGGTGTGCAACAGT
GATCCTCCATGCTATGAGTTCCTGTGGGGTCCACGAGCCTATGCTGAAAC
CACCAAGATGAGAGTCCTGCGTGTTTTGGCCGACAGCAGTAACACCAGTC
CCGGTTTATACCCACATCTGTATGAAGACGCTTTGATAGATGAGGTAGAG
AGAGCATTGAGACTGAGAGCTTACCCAACTTTCTTGTACAAAGTGGTGGT
ACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAG
CTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCT
GCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTA
TGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACG
CTTGA
MPRGHKSKLRTCEKRQETNGQPQGLTGPQATAEKQEESHSSSSSSRACLG
DCRRSSDASIPQESQGVSPTGSPDAVVSYSKSDVAANGQDEKSPSTSRDA
SVPQESQGASPTGSPDAGVSGSKYDVAANGQDEKSPSTSHDVSVPQESQG
ASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKKAC
TLAQFLQKKFEKKESILKADMLKCVRREYKPYFPQILNRTSQHLVVAFGV
ELKEMDSSGESYTLVSKLGLPSEGILSGDNALPKSGLLMSLLVVIFMNGN
CATEEEVWEFLGLLGIYDGILHSIYGDARKIITEDLVQDKYVVYRQVCNS
DPPCYEFLWGPRAYAETTKMRVLRVLADSSNTSPGLYPHLYEDALIDEVE
RALRLRAYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGP
AGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index