Stock Number Hs1411

Human Gene: STAT5B


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
STAT5B signal transducer and activator of transcription 5B HGNC:11367 17q21.2 Stat92E 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03737 pGW-HA.attB ENST00000415845.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166199784813

Sequences

DNA sequence (1404 bp) Protein sequence (468 aa)
ATGGCTGTGTGGATACAAGCTCAGCAGCTCCAAGGAGAAGCCCTTCATCA
GATGCAAGCGTTATATGGCCAGCATTTTCCCATTGAGGTGCGGCATTATT
TATCCCAGTGGATTGAAAGCCAAGCATGGGACTCAGTAGATCTTGATAAT
CCACAGGAGAACATTAAGGCCACCCAGCTCCTGGAGGGCCTGGTGCAGGA
GCTGCAGAAGAAGGCAGAGCACCAGGTGGGGGAAGATGGGTTTTTACTGA
AGATCAAGCTGGGGCACTATGCCACACAGCTCCAGAACACGTATGACCGC
TGCCCCATGGAGCTGGTCCGCTGCATCCGCCATATATTGTACAATGAACA
GAGGTTGGTCCGAGAAGCCAACAATGGTAGCTCTCCAGCTGGAAGCCTTG
CTGATGCCATGTCCCAGAAACACCTCCAGATCAACCAGACGTTTGAGGAG
CTGCGACTGGTCACGCAGGACACAGAGAATGAGTTAAAAAAGCTGCAGCA
GACTCAGGAGTACTTCATCATCCAGTACCAGGAGAGCCTGAGGATCCAAG
CTCAGTTTGGCCCGCTGGCCCAGCTGAGCCCCCAGGAGCGTCTGAGCCGG
GAGACGGCCCTCCAGCAGAAGCAGGTGTCTCTGGAGGCCTGGTTGCAGCG
TGAGGCACAGACACTGCAGCAGTACCGCGTGGAGCTGGCCGAGAAGCACC
AGAAGACCCTGCAGCTGCTGCGGAAGCAGCAGACCATCATCCTGGATGAC
GAGCTGATCCAGTGGAAGCGGCGGCAGCAGCTGGCCGGGAACGGCGGGCC
CCCCGAGGGCAGCCTGGACGTGCTACAGTCCTGGTGTGAGAAGTTGGCCG
AGATCATCTGGCAGAACCGGCAGCAGATCCGCAGGGCTGAGCACCTCTGC
CAGCAGCTGCCCATCCCCGGCCCAGTGGAGGAGATGCTGGCCGAGGTCAA
CGCCACCATCACGGACATTATCTCAGCCCTGGTGACCAGCACGTTCATCA
TTGAGAAGCAGCCTCCTCAGGTCCTGAAGACCCAGACCAAGTTTGCAGCC
ACTGTGCGCCTGCTGGTGGGCGGGAAGCTGAACGTGCACATGAACCCCCC
CCAGGTGAAGGCCACCATCATCAGTGAGCAGCAGGCCAAGTCTCTGCTCA
AGAACGAGAACACCCGCAAGTACCCAACTTTCTTGTACAAAGTGGTGGTA
CCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGC
TCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTG
CGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTAT
GACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGC
TTGA
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDN
PQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDR
CPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEE
LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSR
ETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDD
ELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRKYPTFLYKVVV
PRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPY
DVPDYAGSYPYDVPDYA*

Index