Stock Number Hs1410

Human Gene: SLC5A12


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SLC5A12 solute carrier family 5 member 12 HGNC:28750 11p14.2 CG10444 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03673 pGW-HA.attB ENST00000280467.10 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166199684812

Sequences

DNA sequence (1422 bp) Protein sequence (474 aa)
ATGGAGGTGAAGAACTTTGCAGTTTGGGATTATGTTGTATTTGCAGCCCT
CTTTTTCATTTCCTCTGGAATTGGGGTGTTCTTTGCCATTAAGGAGAGAA
AAAAGGCAACTTCCCGAGAGTTCCTGGTTGGGGGAAGGCAAATGAGCTTT
GGCCCTGTCGGCTTGTCTCTGACAGCCAGCTTCATGTCAGCTGTCACGGT
CCTGGGGACCCCTTCTGAAGTCTACCGCTTTGGGGCATCCTTCCTAGTCT
TCTTCATTGCTTACCTATTTGTCATCCTCTTAACATCAGAGCTCTTTCTC
CCTGTGTTCTACAGATCTGGTATCACCAGCACTTATGAGTACTTACAACT
ACGATTCAACAAACCAGTTCGCTATGCTGCCACAGTCATCTACATTGTAC
AGACGATTCTCTACACAGGAGTGGTGGTGTATGCTCCTGCCCTGGCACTC
AATCAAGTGACTGGGTTTGATCTCTGGGGCTCTGTGTTTGCAACAGGAAT
TGTTTGCACATTCTACTGTACCCTGGGAGGATTAAAAGCAGTGGTGTGGA
CAGATGCATTTCAGATGGTTGTCATGATTGTGGGCTTCTTAACGGTTCTC
ATTCAAGGATCAACTCATGCTGGGGGATTCCACAATGTATTAGAGCAATC
AACAAATGGATCTCGACTACATATATTTGACTTTGATGTAGATCCTCTCA
GGCGACACACTTTTTGGACTATCACAGTGGGAGGAACTTTTACTTGGCTC
GGAATCTATGGGGTCAATCAATCAACTATTCAGCGATGCATCTCTTGCAA
AACAGAAAAGCATGCTAAGCTTGCCTTGTATTTTAACTTGCTGGGTCTCT
GGATCATTCTGGTGTGTGCTGTCTTCTCTGGCTTAATCATGTACTCTCAC
TTTAAAGACTGTGACCCTTGGACTTCTGGCATCATCTCAGCACCAGACCA
GCTGATGCCGTACTTTGTCATGGAGATATTTGCCACAATGCCAGGACTGC
CAGGACTTTTTGTGGCTTGTGCCTTCAGTGGAACTCTGAGCACCGTGGCT
TCCAGCATCAATGCCTTGGCAACAGTGACCTTTGAGGATTTTGTCAAGAG
CTGTTTTCCTCATCTCTCCGACAAGCTGAGCACCTGGATCAGTAAAGGCT
TATGTAGGTACAGCTGGTGGACTTTCTATTCCATATCATTGCCAACTTTC
TTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGG
AACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTG
GTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGAC
TATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATA
TGACGTTCCAGATTACGCTTGA
MEVKNFAVWDYVVFAALFFISSGIGVFFAIKERKKATSREFLVGGRQMSF
GPVGLSLTASFMSAVTVLGTPSEVYRFGASFLVFFIAYLFVILLTSELFL
PVFYRSGITSTYEYLQLRFNKPVRYAATVIYIVQTILYTGVVVYAPALAL
NQVTGFDLWGSVFATGIVCTFYCTLGGLKAVVWTDAFQMVVMIVGFLTVL
IQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTFWTITVGGTFTWL
GIYGVNQSTIQRCISCKTEKHAKLALYFNLLGLWIILVCAVFSGLIMYSH
FKDCDPWTSGIISAPDQLMPYFVMEIFATMPGLPGLFVACAFSGTLSTVA
SSINALATVTFEDFVKSCFPHLSDKLSTWISKGLCRYSWWTFYSISLPTF
LYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPD
YAGYPYDVPDYAGSYPYDVPDYA*

Index