Stock Number Hs1409

Human Gene: KLF12


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
KLF12 Kruppel like factor 12 HGNC:6346 13q22.1 CG42741 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03693 pGW-HA.attB ENST00000377669.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166199584811

Sequences

DNA sequence (1440 bp) Protein sequence (480 aa)
ATGAATATCCATATGAAGAGAAAAACAATAAAGAATATCAACACCTTTGA
GAACAGAATGTTAATGCTTGATGGGATGCCGGCAGTCAGAGTCAAAACAG
AGCTTTTGGAATCTGAACAAGGGTCTCCAAACGTCCACAACTATCCCGAT
ATGGAAGCCGTTCCCCTGTTGCTAAATAATGTGAAAGGGGAGCCCCCGGA
GGACTCGTTATCTGTAGATCACTTCCAAACACAAACTGAGCCAGTGGACT
TGTCAATAAACAAAGCCAGGACGTCCCCTACTGCCGTTTCATCCTCCCCA
GTTTCCATGACAGCATCTGCCTCCTCACCTTCTTCAACTTCAACCTCTTC
ATCGTCTTCTAGTCGTCTAGCCTCATCCCCAACTGTTATCACATCAGTAT
CTTCAGCGTCATCTTCGTCAACAGTATTAACTCCAGGGCCCCTTGTGGCC
TCTGCATCTGGTGTTGGAGGCCAGCAGTTTTTGCACATTATCCATCCCGT
ACCGCCTTCAAGTCCCATGAATTTACAGTCTAACAAACTGAGTCATGTTC
ACCGCATCCCCGTGGTGGTACAGTCGGTGCCTGTTGTCTACACAGCTGTA
AGGTCACCTGGAAATGTGAACAACACTATTGTCGTGCCGCTTTTGGAGGA
TGGGAGAGGCCATGGCAAAGCACAAATGGACCCCCGAGGCCTATCTCCCA
GACAAAGTAAAAGTGACAGTGATGATGATGACCTGCCAAATGTGACCTTA
GATAGCGTTAATGAAACTGGATCTACGGCCCTTTCCATAGCCAGAGCAGT
ACAAGAGGTACATCCGTCCCCAGTATCAAGGGTCCGGGGAAATCGAATGA
ATAATCAAAAGTTTCCTTGTTCAATTTCACCATTTAGTATTGAGAGCACA
AGACGCCAGAGACGGTCTGAATCCCCAGACTCCAGAAAACGGCGTATCCA
CAGATGTGATTTTGAGGGATGCAACAAAGTGTACACAAAAAGTTCTCACC
TGAAGGCTCACCGGAGGACACATACAGGAGAGAAACCTTACAAGTGTACC
TGGGAAGGCTGCACCTGGAAGTTCGCTCGTTCAGATGAACTGACGAGGCA
TTACCGCAAACATACGGGAGTGAAGCCATTCAAGTGCGCGGACTGTGATC
GCAGCTTTTCCCGGTCAGATCATTTGGCCCTGCACCGCCGGAGGCATATG
TTGGTGTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTA
TTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCG
GTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTAC
CCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTA
TGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPD
MEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSP
VSMTASASSPSSTSTSSSSSSRLASSPTVITSVSSASSSSTVLTPGPLVA
SASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAV
RSPGNVNNTIVVPLLEDGRGHGKAQMDPRGLSPRQSKSDSDDDDLPNVTL
DSVNETGSTALSIARAVQEVHPSPVSRVRGNRMNNQKFPCSISPFSIEST
RRQRRSESPDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCT
WEGCTWKFARSDELTRHYRKHTGVKPFKCADCDRSFSRSDHLALHRRRHM
LVCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIY
PYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index