Stock Number Hs1408

Human Gene: SEC14L2


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SEC14L2 SEC14 like lipid binding 2 HGNC:10699 22q12.2 CG13893 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03692 pGW-HA.attB ENST00000615189.4 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166199484810

Sequences

DNA sequence (1440 bp) Protein sequence (480 aa)
ATGAGCGGCAGAGTCGGCGATCTGAGCCCCAGGCAGAAGGAGGCATTGGC
CAAGTTTCGGGAGAATGTCCAGGATGTGCTGCCGGCCCTGCCGAATCCAG
ATGACTATTTTCTCCTGCGTTGGCTCCGAGCCAGAAGCTTCGACCTGCAG
AAGTCGGAGGCCATGCTCCGGAAGCATGTGGAGTTCCGAAAGCAAAAGGA
CATTGACAACATCATTAGCTGGCAGCCTCCAGAGGTGATCCAACAGTATC
TGTCAGGGGGTATGTGTGGCTATGACCTGGATGGCTGCCCAGTCTGGTAC
GACATAATTGGACCTCTGGATGCCAAGGGTCTGCTGTTCTCAGCCTCCAA
ACAGGACCTGCTGAGGACCAAGATGCGGGAGTGTGAGCTGCTTCTGCAAG
AGTGTGCCCACCAGACCACAAAGTTGGGGAGGAAGGTGGAGACCATCACC
ATAATTTATGACTGCGAGGGGCTTGGCCTCAAGCATCTCTGGAAGCCTGC
TGTGGAGGCCTATGGAGAGTTTCTCTGCATGTTTGAGGAAAATTATCCCG
AAACACTGAAGCGTCTTTTTGTTGTTAAAGCCCCCAAACTGTTTCCTGTG
GCCTATAACCTCATCAAACCCTTCCTGAGTGAGGACACTCGTAAGAAGAT
CATGGTCCTGGGAGCAAATTGGAAGGAGGTTTTACTGAAACATATCAGCC
CTGACCAGGTGCCTGTGGAGTATGGGGGCACCATGACTGACCCTGATGGA
AACCCCAAGTGCAAATCCAAGATCAACTACGGGGGTGACATCCCCAGGAA
GTATTATGTGCGAGACCAGGTGAAACAGCAGTATGAACACAGCGTGCAGA
TTTCCCGTGGCTCCTCCCACCAAGTGGAGTATGAGATCCTCTTCCCTGGC
TGTGTCCTCAGGTGGCAGTTTATGTCAGATGGAGCGGATGTTGGTTTTGG
GATTTTCCTGAAGACCAAGATGGGAGAGAGGCAGCGGGCAGGGGAGATGA
CAGAGGTGCTGCCCAACCAGAGGTACAACTCCCACCTGGTCCCTGAAGAT
GGGACCCTCACCTGCAGTGATCCTGGCATCTATGTCCTGCGGTTTGACAA
CACCTACAGCTTCATTCATGCCAAGAAGGTCAATTTCACTGTGGAGGTCC
TGCTTCCAGACAAAGCCTCAGAAGAGAAGATGAAACAGCTGGGGGCAGGC
ACCCCGAAACCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTA
TTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCG
GTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTAC
CCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTA
TGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQ
KSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWY
DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETIT
IIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPV
AYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDG
NPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPG
CVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPED
GTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAG
TPKPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIY
PYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index