Stock Number Hs1406

Human Gene: MFNG


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
MFNG MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase HGNC:7038 22q13.1 fng 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02802 pGW-HA.attB ENST00000442496.1 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166199284808

Sequences

DNA sequence (1194 bp) Protein sequence (398 aa)
ATGCAGTGCCGGCTCCCGCGGGGCCTGGCTGGAGCCCTCCTCACCCTCCT
GTGCATGGGGCTCCTGTGTCTGCGGTACCACTTGAACCTGTCCCCGCAGC
GGGTACAAGGGACCCCCGAGCTGAGCCAGCCGAACCCGGGGCCCCCTAAG
CTACAGCTACACGATGTCTTCATTGCAGTGAAGACGACCCGGGCTTTCCA
CCGCTTGCGCCTGGAGCTGCTGCTTGACACGTGGGTTTCCAGGACCAGGG
AACAGACATTTGTCTTCACCGACAGCCCAGACAAAGGCCTCCAGGAGAGA
CTGGGGTCCCACCTTGTGGTCACCAACTGCTCCGCGGAACACAGCCACCC
AGCTCTGTCCTGCAAGATGGCTGCTGAGTTCGACACCTTCTTGGCCAGTG
GGCTTAGGTGGTTCTGCCATGTGGACGATGACAACTATGTGAACCCAAGG
GCGCTGCTGCAGCTTCTGAGAGCCTTCCCGCTGGCCCGCGACGTCTATGT
GGGAAGGCCCAGCCTGAACCGGCCCATCCATGCCTCAGAGCCACAGCCCC
ACAACCGCACGAGGCTGGTACAGTTCTGGTTTGCCACTGGGGGTGCTGGC
TTCTGCATCAATCGCAAACTGGCTTTGAAGATGGCTCCGTGGGCCAGTGG
CTCCCGTTTCATGGACACATCTGCTCTCATCCGGCTGCCTGATGACTGCA
CCATGGGCTATATCATTGAGTGCAAGCTGGGCGGCCGCCTGCAGCCCAGC
CCCCTCTTTCACTCCCACCTGGAGACCCTGCAGCTGCTGAGGACTGCACA
GCTCCCAGAACAGGTCACCCTCAGCTACGGTGTCTTTGAGGGGAAACTCA
ACGTCATTAAGCTACAGGGCCCCTTCTCCCCGGAGGAGGACCCCTCCAGA
TTTCGCTCCCTCCATTGTCTGCTCTATCCAGATACACCCTGGTGTCCCCA
GCTGGGTGCCCGACCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTT
CCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGA
GGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAAT
TTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGG
ACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPK
LQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQER
LGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPR
ALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAG
FCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPS
PLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FRSLHCLLYPDTPWCPQLGARPTFLYKVVVPRSSYSLLSIGTSILGAPSG
GGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index