Stock Number Hs1405

Human Gene: ZDHHC20


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ZDHHC20 zinc finger DHHC-type containing 20 HGNC:20749 13q12.11 CG1407 2R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02801 pGW-HA.attB ENST00000320220.13 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166199184807

Sequences

DNA sequence (1194 bp) Protein sequence (398 aa)
ATGGCGCCCTGGACGCTGTGGCGCTGCTGCCAGCGCGTCGTGGGCTGGGT
GCCGGTGCTCTTCATCACCTTCGTGGTCGTCTGGTCCTACTACGCGTACG
TGGTGGAGCTCTGCGTGTTTACTATTTTTGGAAATGAAGAAAATGGAAAG
ACCGTTGTTTACCTTGTGGCTTTCCATCTGTTCTTTGTTATGTTTGTATG
GTCCTATTGGATGACAATTTTCACATCTCCCGCTTCCCCCTCCAAAGAGT
TCTACTTGTCCAATTCTGAAAAGGAACGTTATGAAAAAGAATTCAGCCAA
GAAAGACAACAAGAAATTTTGAGAAGAGCAGCAAGAGCTTTACCTATCTA
TACCACATCAGCTTCAAAAACTATCAGATATTGTGAAAAATGTCAGCTGA
TTAAACCTGATCGGGCGCATCACTGCTCAGCCTGTGACTCATGTATTCTT
AAGATGGATCATCACTGTCCTTGGGTGAATAACTGTGTGGGATTTTCTAA
TTACAAATTCTTCCTGCTGTTTTTATTGTATTCCCTATTATATTGCCTTT
TCGTGGCTGCAACAGTTTTAGAGTACTTTATAAAATTTTGGACGAATGAA
CTGACAGATACACGTGCAAAATTCCACGTACTTTTTCTTTTCTTTGTGTC
TGCAATGTTCTTCATCAGCGTCCTCTCACTTTTCAGCTACCACTGCTGGC
TAGTTGGAAAAAATAGAACAACAATAGAATCATTCCGCGCACCCACGTTT
TCATACGGACCTGATGGAAATGGTTTCTCTCTTGGATGCAGTAAAAATTG
GAGACAAGTCTTTGGTGATGAAAAGAAATATTGGCTACTTCCAATATTTT
CAAGCTTGGGTGATGGTTGCAGTTTTCCAACTCGCCTTGTGGGGATGGAT
CCAGAACAAGCTTCTGTTACAAACCAGAATGAGTATGCCAGAAGATCTAA
ACTGCAGAGGTTGCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTT
CCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGA
GGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAAT
TTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGG
ACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGK
TVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQ
ERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCIL
KMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNE
LTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTF
SYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMD
PEQASVTNQNEYARRSKLQRLPTFLYKVVVPRSSYSLLSIGTSILGAPSG
GGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index