Stock Number Hs1404

Human Gene: CHORDC1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CHORDC1 cysteine and histidine rich domain containing 1 HGNC:14525 11q14.3 CHORD 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02874 pGW-HA.attB ENST00000457199.6 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166199084806

Sequences

DNA sequence (1230 bp) Protein sequence (410 aa)
ATGGCCTTGCTGTGCTACAACCGGGGCTGCGGTCAGCGCTTCGATCCTGA
GACCAATTCCGACGATGCTTGCACATACCACCCAGGTGTTCCGGTCTTTC
ACGATGCATTAAAGGGTTGGTCTTGCTGTAAGAGAAGAACAACTGATTTT
TCTGATTTCTTAAGCATTGTAGGCTGTACAAAAGGTAGACATAATAGTGA
GAAGCCACCTGAGCCAGTCAAACCTGAAGTCAAGACTACTGAGAAGAAGG
AGCTATGTGAATTAAAACCCAAATTTCAGGAACACATCATTCAAGCCCCT
AAGCCAGTAGAAGCAATAAAAAGACCAAGCCCAGATGAACCAATGACAAA
TTTGGAATTAAAAATATCTGCCTCCCTAAAACAAGCACTTGATAAACTTA
AACTGTCATCAGGGAATGAAGAAAATAAGAAAGAAGAAGACAATGATGAA
ATTAAGATTGGGACCTCATGTAAGAATGGAGGGTGTTCAAAGACATACCA
GGGTCTAGAGAGTCTAGAAGAAGTCTGTGTATATCATTCTGGAGTACCTA
TTTTCCATGAGGGGATGAAATACTGGAGCTGTTGTAGAAGAAAAACTTCT
GATTTTAATACATTCTTAGCCCAAGAGGGCTGTACAAAAGGGAAACACAT
GTGGACTAAAAAAGATGCTGGGAAAAAAGTTGTTCCATGTAGACATGACT
GGCATCAGACTGGAGGTGAAGTTACCATTTCAGTATATGCTAAAAACTCA
CTTCCAGAACTTAGCCGAGTAGAAGCAAATAGCACATTGTTAAATGTGCA
TATTGTATTTGAAGGAGAGAAGGAATTTGATCAAAATGTGAAATTATGGG
GTGTGATTGATGTAAAGCGAAGTTATGTAACTATGACTGCAACAAAGATT
GAAATCACTATGAGAAAAGCTGAACCGATGCAGTGGGCAAGCCTTGAACT
GCCTGCAGCTAAAAAGCAGGAAAAACAAAAAGATGCCACAACAGATTGCC
CAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTT
AGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGC
TGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATG
TTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCC
TATCCATATGACGTTCCAGATTACGCTTGA
MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDF
SDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAP
KPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDE
IKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTS
DFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNS
LPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKI
EITMRKAEPMQWASLELPAAKKQEKQKDATTDCPTFLYKVVVPRSSYSLL
SIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGS
YPYDVPDYA*

Index