Stock Number Hs1402

Human Gene: RCN1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RCN1 reticulocalbin 1 HGNC:9934 11p13 scf 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02865 pGW-HA.attB ENST00000054950.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166198884805

Sequences

DNA sequence (1227 bp) Protein sequence (409 aa)
ATGGCGCGCGGTGGCCGCGGCCGCCGCCTGGGGTTAGCCCTGGGGCTGCT
GCTGGCGCTGGTGCTGGCGCCGCGGGTTCTGCGGGCCAAGCCCACGGTGC
GCAAAGAGCGCGTGGTGCGGCCCGACTCGGAGCTGGGCGAGCGGCCCCCT
GAGGACAACCAGAGCTTCCAGTACGACCACGAGGCCTTCCTGGGCAAGGA
GGACTCCAAGACCTTCGACCAGCTCACCCCGGACGAGAGCAAGGAGAGGC
TAGGGAAGATTGTTGATCGAATCGACAATGATGGGGATGGCTTTGTCACT
ACTGAGGAGCTGAAAACCTGGATCAAACGGGTGCAGAAAAGATACATCTT
TGATAATGTCGCCAAAGTCTGGAAGGATTATGATAGGGACAAGGATGATA
AAATTTCCTGGGAAGAATACAAACAAGCCACCTATGGTTACTACCTAGGA
AACCCCGCAGAGTTTCATGATTCTTCAGATCATCACACCTTTAAAAAGAT
GCTGCCACGTGATGAGAGAAGATTCAAAGCTGCAGACCTCAATGGTGACC
TGACAGCTACTCGGGAGGAGTTCACTGCCTTTCTGCATCCTGAAGAGTTT
GAACATATGAAGGAAATTGTGGTTTTGGAAACCCTGGAGGACATCGACAA
GAACGGGGATGGGTTTGTGGATCAGGATGAGTATATTGCGGATATGTTTT
CCCATGAGGAGAATGGCCCTGAGCCAGACTGGGTTTTATCAGAACGGGAG
CAGTTTAACGAATTCCGGGATCTGAACAAGGACGGGAAGTTAGACAAAGA
TGAGATTCGCCACTGGATCCTCCCTCAAGATTATGATCATGCACAGGCTG
AGGCCAGGCATCTGGTATATGAATCAGACAAAAACAAGGATGAGAAGCTA
ACTAAAGAGGAAATATTGGAGAACTGGAACATGTTTGTCGGAAGCCAAGC
TACCAATTACGGGGAAGATCTCACAAAAAATCATGATGAGCTTTGCCCAA
CTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGT
ATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGG
CGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTC
CTGACTATGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTAT
CCATATGACGTTCCAGATTACGCTTGA
MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPP
EDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVT
TEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLG
NPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEF
EHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSERE
QFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKL
TKEEILENWNMFVGSQATNYGEDLTKNHDELCPTFLYKVVVPRSSYSLLS
IGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSY
PYDVPDYA*

Index