Stock Number Hs1399

Human Gene: SLC25A14


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SLC25A14 solute carrier family 25 member 14 HGNC:10984 Xq26.1 Bmcp 3L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02827 pGW-HA.attB ENST00000545805.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166198584804

Sequences

DNA sequence (1209 bp) Protein sequence (403 aa)
ATGGGTATCTTTCCCGGAATAATCCTAATTTTTCTAAGGGTGAAGTTTGC
AACGGCGGCCGTGATTGTAAGCGGACACCAGAAAAGTACCACTGTAAGTC
ATGAGATGTCTGGTCTGAATTGGAAACCCTTTGTATATGGCGGCCTTGCC
TCTATCGTGGCTGAGTTTGGGACTTTCCCTGTGGACCTTACCAAAACACG
ACTTCAGGTTCAAGGCCAAAGCATTGATGCCCGTTTCAAAGAGATAAAAT
ATAGAGGGATGTTCCATGCGCTGTTTCGCATCTGTAAAGAGGAAGGTGTA
TTGGCTCTCTATTCAGGAATTGCTCCTGCGTTGCTAAGACAAGCATCATA
TGGCACCATTAAAATTGGGATTTACCAAAGCTTGAAGCGCTTATTCGTAG
AACGTTTAGAAGATGAAACTCTTTTAATTAATATGATCTGTGGGGTAGTG
TCAGGAGTGATATCTTCCACTATAGCCAATCCCACCGATGTTCTAAAGAT
TCGAATGCAGGCTCAAGGAAGCTTGTTCCAAGGGAGCATGATTGGAAGCT
TTATCGATATATACCAACAAGAAGGCACCAGGGGTCTGTGGAGGGGTGTG
GTTCCAACTGCTCAGCGTGCTGCCATCGTTGTAGGAGTAGAGCTACCAGT
CTATGATATTACTAAGAAGCATTTAATATTGTCAGGAATGATGGGCGATA
CAATTTTAACTCACTTCGTTTCCAGCTTTACATGTGGTTTGGCTGGGGCT
CTGGCCTCCAACCCGGTTGATGTGGTTCGAACTCGCATGATGAACCAGAG
GGCAATCGTGGGACATGTGGATCTCTATAAGGGCACTGTTGATGGTATTT
TAAAGATGTGGAAACATGAGGGCTTTTTTGCACTCTATAAAGGATTTTGG
CCAAACTGGCTTCGGCTTGGACCCTGGAACATCATTTTTTTTATTACATA
CGAGCAGCTAAAGAGGCTTCAAATCTTGCCAACTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLA
SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV
LALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVV
SGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGV
VPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGA
LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFW
PNWLRLGPWNIIFFITYEQLKRLQILPTFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index