Stock Number Hs1398

Human Gene: PLCXD3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
PLCXD3 phosphatidylinositol specific phospholipase C X domain containing 3 HGNC:31822 5p13.1 CG10747 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02803 pGW-HA.attB ENST00000328457.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166198484803

Sequences

DNA sequence (1209 bp) Protein sequence (403 aa)
ATGGCCTCGTCTCAGGGGAAAAACGAGCTGAAATTAGCCGACTGGATGGC
AACTCTGCCGGAGAGCATGCACAGCATCCCCCTCACCAATTTAGCCATTC
CAGGGTCTCATGATTCCTTCAGCTTCTACATTGATGAAGCCTCTCCAGTA
GGTCCTGAGCAGCCAGAAACTGTCCAGAATTTTGTCTCTGTGTTTGGAAC
TGTGGCCAAAAAGCTCATGCGGAAATGGTTAGCCACTCAGACAATGAATT
TTACTGGCCAGCTAGGAGCTGGAATTCGTTATTTTGATCTTCGAATTTCC
ACCAAGCCCAGAGACCCCGACAATGAACTCTATTTTGCTCATGGTTTGTT
CAGTGCCAAAGTCAATGAAGGCCTTGAGGAGATCAATGCATTCCTCACAG
ATCACCATAAGGAGGTAGTGTTCTTGGACTTCAACCACTTTTATGGGATG
CAGAAATATCACCATGAAAAACTGGTCCAAATGCTGAAAGACATCTATGG
AAATAAAATGTGCCCAGCGATTTTTGCCCAGGAAGTTAGTTTAAAGTACC
TGTGGGAGAAGGACTATCAAGTGCTGGTCTTCTACCATAGTCCAGTGGCT
CTGGAAGTGCCCTTTCTCTGGCCTGGGCAGATGATGCCAGCACCCTGGGC
CAACACCACAGACCCCGAGAAACTGATCCAGTTTCTTCAAGCATCCATCA
CTGAGAGAAGAAAGAAGGGATCGTTTTTTATATCTCAGGTGGTGCTGACC
CCCAAAGCTAGCACTGTGGTCAAAGGGGTGGCAAGTGGCCTCAGAGAAAC
AATCACAGAAAGAGCTCTTCCTGCCATGATGCAGTGGGTCCGCACGCAGA
AGCCAGGAGAGAGTGGCATCAATATTGTCACTGCCGATTTTGTAGAACTT
GGTGACTTTATCAGCACTGTCATAAAGCTCAACTATGTCTTTGATGAAGG
AGAAGCCAACACTTCAGGCCTCATGGGCCCAGCTTTCTTGTACAAAGTGG
TGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTT
GGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGG
ACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTATC
CCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGAT
TACGCTTGA
MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPV
GPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRIS
TKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFNHFYGM
QKYHHEKLVQMLKDIYGNKMCPAIFAQEVSLKYLWEKDYQVLVFYHSPVA
LEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLT
PKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVEL
GDFISTVIKLNYVFDEGEANTSGLMGPAFLYKVVVPRSSYSLLSIGTSIL
GAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPD
YA*

Index