Stock Number Hs1397

Human Gene: CA10


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
CA10 carbonic anhydrase 10 HGNC:1369 17q21.33-q22 CARPB X

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02850 pGW-HA.attB ENST00000285273.8 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166198384802

Sequences

DNA sequence (1218 bp) Protein sequence (406 aa)
ATGGAAATAGTCTGGGAGGTGCTTTTTCTTCTTCAAGCCAATTTCATCGT
CTGCATATCAGCTCAACAGAATTCACCAAAAATCCATGAAGGCTGGTGGG
CATACAAGGAGGTGGTCCAGGGAAGCTTTGTTCCAGTTCCTTCTTTCTGG
GGATTGGTGAACTCAGCTTGGAATCTTTGCTCTGTGGGGAAACGGCAGTC
GCCAGTCAACATAGAGACCAGTCACATGATCTTCGACCCCTTTCTGACAC
CTCTTCGCATCAACACGGGGGGCAGGAAGGTCAGTGGGACCATGTACAAC
ACTGGAAGACACGTATCCCTTCGCCTGGACAAGGAGCACTTGGTCAACAT
ATCTGGAGGGCCCATGACATACAGCCACCGGCTGGAGGAGATCCGACTAC
ACTTTGGGAGTGAGGACAGCCAAGGGTCGGAGCACCTCCTCAATGGACAG
GCCTTCTCTGGGGAGGTGCAGCTCATCCACTATAACCATGAGCTATATAC
GAATGTCACAGAAGCTGCAAAGAGTCCAAATGGATTGGTGGTAGTTTCTA
TATTTATAAAAGTTTCTGATTCATCAAACCCATTTCTTAATCGAATGCTC
AACAGAGATACTATCACAAGAATAACATATAAAAATGATGCATATTTACT
ACAGGGGCTTAATATAGAGGAACTATATCCAGAGACCTCTAGTTTCATCA
CTTACGATGGGTCGATGACTATCCCACCCTGCTATGAGACAGCAAGTTGG
ATCATAATGAACAAACCTGTCTATATAACCAGGATGCAGATGCATTCCTT
GCGCCTGCTCAGCCAGAACCAGCCATCTCAGATCTTTCTGAGCATGAGTG
ACAACTTCAGGCCTGTCCAGCCACTCAACAACCGCTGCATCCGCACCAAT
ATCAACTTCAGTTTACAGGGGAAGGACTGTCCAAACAACCGAGCCCAGAA
GCTTCAGTATAGAGTAAATGAATGGCTCCTCAAGTACCCAACTTTCTTGT
ACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACT
TCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGG
AGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATG
CGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGAC
GTTCCAGATTACGCTTGA
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFW
GLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYN
TGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQ
AFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRML
NRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASW
IIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN
INFSLQGKDCPNNRAQKLQYRVNEWLLKYPTFLYKVVVPRSSYSLLSIGT
SILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYD
VPDYA*

Index