Stock Number Hs1396

Human Gene: RSBN1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RSBN1 round spermatid basic protein 1 HGNC:25642 1p13.2 CG10600 2L

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03840 pGW-HA.attB ENST00000476412.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK33166198284801

Sequences

DNA sequence (1467 bp) Protein sequence (489 aa)
ATGGCTGCGCAGGTCGGAGCGGTGCGCGTAGTACGGGCGGTGGCGGCGCA
GGAGGAGCCGGACAAAGAGGGGAAGGAGAAACCTCATGCTGGGGTCTCCC
CGCGGGGAGTTAAACGGCAGCGCCGATCTAGCAGTGGGGGGTCTCAGGAG
AAGCGGGGGCGGCCGAGCCAGGAGCCCCCTCTCGCTCCCCCTCACCGGCG
GCGTCGCAGCCGCCAACATCCTGGGCCGCTGCCGCCAACGAATGCAGCCC
CAACTGTCCCAGGCCCTGTTGAGCCTCTTCTCCTGCCGCCTCCGCCGCCA
CCTTCGCTGGCACCCGCCGGGCCCGCTGTCGCTGCCCCTCTCCCGGCCCC
AAGCACCTCGGCCCTCTTCACCTTCTCGCCTCTGACGGTGAGCGCGGCCG
GGCCCAAGCATAAGGGCCACAAGGAGCGGCACAAGCACCATCACCACCGC
GGCCCCGATGGTGATCCCAGCTCCTGCGGAACCGATCTCAAGCACAAGGA
CAAGCAGGAAAACGGCGAGAGGACTGGAGGGGTGCCTCTGATCAAAGCCC
CCAAGAGAGAAACACCAGATGAAAATGGTAAAACCCAGAGAGCCGATGAT
TTTGTCTTGAAGAAAATAAAGAAGAAAAAGAAAAAGAAACACCGAGAAGA
CATGCGAGGAAGACGCCTTAAAATGTACAATAAGGAAGTACAAACCGTCT
GTGCTGGCCTGACCCGCATCAGTAAAGAAATTCTCACCCAAGGACAAATA
AATAGCACTTCAGGACTTAATAAGGAGTCCTTCAGGTATCTGAAAGATGA
ACAGCTGTGCCGATTAAATTTGGGTATGCAAGAATATCGGGTACCCCAGG
GAGTACAAACACCTTTTATGACTCACCAGGAACATTCTATTCGTAGAAAT
TTCTTAAAAACAGGTACTAAATTTAGCAACTTTATTCATGAGGAACACCA
GTCCAATGGTGGTGCTCTTGTCCTTCATGCTTACATGGATGAACTCTCAT
TTTTGTCTCCAATGGAGATGGAGAGATTTTCTGAGGAGTTTCTTGCTTTG
ACATTCAGTGAAAATGAGAAAAATGCTGCTTACTATGCTTTAGCAATAGT
GCATGGAGCGGCTGCTTATCTCCCAGACTTCTTGGACTACTTTGCTTTTA
ATTTCCCCAACACTCCAGTGAAAATGGAAATTCTGGGCAAGAAAGATATT
GAAACAACCACCATTTCAAATTTTCACACTCAGTACCCAACTTTCTTGTA
CAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTT
CCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGA
GCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGC
GGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACG
TTCCAGATTACGCTTGA
MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQE
KRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPP
PSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHR
GPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADD
FVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQI
NSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRN
FLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLAL
TFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDI
ETTTISNFHTQYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGG
AGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index