Stock Number Hs1395

Human Gene: ADORA2A


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ADORA2A adenosine A2a receptor HGNC:263 22q11.23 AdoR 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03848 pGW-HA.attB ENST00000424232.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166198184800

Sequences

DNA sequence (1470 bp) Protein sequence (490 aa)
ATGCCCATCATGGGCTCCTCGGTGTACATCACGGTGGAGCTGGCCATTGC
TGTGCTGGCCATCCTGGGCAATGTGCTGGTGTGCTGGGCCGTGTGGCTCA
ACAGCAACCTGCAGAACGTCACCAACTACTTTGTGGTGTCACTGGCGGCG
GCCGACATCGCAGTGGGTGTGCTCGCCATCCCCTTTGCCATCACCATCAG
CACCGGGTTCTGCGCTGCCTGCCACGGCTGCCTCTTCATTGCCTGCTTCG
TCCTGGTCCTCACGCAGAGCTCCATCTTCAGTCTCCTGGCCATCGCCATT
GACCGCTACATTGCCATCCGCATCCCGCTCCGGTACAATGGCTTGGTGAC
CGGCACGAGGGCTAAGGGCATCATTGCCATCTGCTGGGTGCTGTCGTTTG
CCATCGGCCTGACTCCCATGCTAGGTTGGAACAACTGCGGTCAGCCAAAG
GAGGGCAAGAACCACTCCCAGGGCTGCGGGGAGGGCCAAGTGGCCTGTCT
CTTTGAGGATGTGGTCCCCATGAACTACATGGTGTACTTCAACTTCTTTG
CCTGTGTGCTGGTGCCCCTGCTGCTCATGCTGGGTGTCTATTTGCGGATC
TTCCTGGCGGCGCGACGACAGCTGAAGCAGATGGAGAGCCAGCCTCTGCC
GGGGGAGCGGGCACGGTCCACACTGCAGAAGGAGGTCCATGCTGCCAAGT
CACTGGCCATCATTGTGGGGCTCTTTGCCCTCTGCTGGCTGCCCCTACAC
ATCATCAACTGCTTCACTTTCTTCTGCCCCGACTGCAGCCACGCCCCTCT
CTGGCTCATGTACCTGGCCATCGTCCTCTCCCACACCAATTCGGTTGTGA
ATCCCTTCATCTACGCCTACCGTATCCGCGAGTTCCGCCAGACCTTCCGC
AAGATCATTCGCAGCCACGTCCTGAGGCAGCAAGAACCTTTCAAGGCAGC
TGGCACCAGTGCCCGGGTCTTGGCAGCTCATGGCAGTGACGGAGAGCAGG
TCAGCCTCCGTCTCAACGGCCACCCGCCAGGAGTGTGGGCCAACGGCAGT
GCTCCCCACCCTGAGCGGAGGCCCAATGGCTACGCCCTGGGGCTGGTGAG
TGGAGGGAGTGCCCAAGAGTCCCAGGGGAACACGGGCCTCCCAGACGTGG
AGCTCCTTAGCCATGAGCTCAAGGGAGTGTGCCCAGAGCCCCCTGGCCTA
GATGACCCCCTGGCCCAGGATGGAGCAGGAGTGTCCTGCCCAACTTTCTT
GTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAA
CTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGT
GGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTA
TGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATG
ACGTTCCAGATTACGCTTGA
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAA
ADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAI
DRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPK
EGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRI
FLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLH
IINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGS
APHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGL
DDPLAQDGAGVSCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAG
GAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index