Stock Number Hs1394

Human Gene: SUV39H1


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
SUV39H1 suppressor of variegation 3-9 homolog 1 HGNC:11479 Xp11.23 eIF2gamma 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03847 pGW-HA.attB ENST00000376687.3 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166198084799

Sequences

DNA sequence (1470 bp) Protein sequence (490 aa)
ATGGCGGAAAATTTAAAAGGCTGCAGCGTGTGTTGCAAGTCTTCTTGGAA
TCAGCTGCAGGACCTGTGCCGCCTGGCCAAGCTCTCCTGCCCTGCCCTCG
GTATCTCTAAGAGGAACCTCTATGACTTTGAAGTCGAGTACCTGTGCGAT
TACAAGAAGATCCGCGAACAGGAATATTACCTGGTGAAATGGCGTGGATA
TCCAGACTCAGAGAGCACCTGGGAGCCACGGCAGAATCTCAAGTGTGTGC
GTATCCTCAAGCAGTTCCACAAGGACTTAGAAAGGGAGCTGCTCCGGCGG
CACCACCGGTCAAAGACCCCCCGGCACCTGGACCCAAGCTTGGCCAACTA
CCTGGTGCAGAAGGCCAAGCAGAGGCGGGCGCTCCGTCGCTGGGAGCAGG
AGCTCAATGCCAAGCGCAGCCATCTGGGACGCATCACTGTAGAGAATGAG
GTGGACCTGGACGGCCCTCCGCGGGCCTTCGTGTACATCAATGAGTACCG
TGTTGGTGAGGGCATCACCCTCAACCAGGTGGCTGTGGGCTGCGAGTGCC
AGGACTGTCTGTGGGCACCCACTGGAGGCTGCTGCCCGGGGGCGTCACTG
CACAAGTTTGCCTACAATGACCAGGGCCAGGTGCGGCTTCGAGCCGGGCT
GCCCATCTACGAGTGCAACTCCCGCTGCCGCTGCGGCTATGACTGCCCAA
ATCGTGTGGTACAGAAGGGTATCCGATATGACCTCTGCATCTTCCGCACG
GATGATGGGCGTGGCTGGGGCGTCCGCACCCTGGAGAAGATTCGCAAGAA
CAGCTTCGTCATGGAGTACGTGGGAGAGATCATTACCTCAGAGGAGGCAG
AGCGGCGGGGCCAGATCTACGACCGTCAGGGCGCCACCTACCTCTTTGAC
CTGGACTACGTGGAGGACGTGTACACCGTGGATGCCGCCTACTATGGCAA
CATCTCCCACTTTGTCAACCACAGTTGTGACCCCAACCTGCAGGTGTACA
ACGTCTTCATAGACAACCTTGACGAGCGGCTGCCCCGCATCGCTTTCTTT
GCCACAAGAACCATCCGGGCAGGCGAGGAGCTCACCTTTGATTACAACAT
GCAAGTGGACCCCGTGGACATGGAGAGCACCCGCATGGACTCCAACTTTG
GCCTGGCTGGGCTCCCTGGCTCCCCTAAGAAGCGGGTCCGTATTGAATGC
AAGTGTGGGACTGAGTCCTGCCGCAAATACCTCTTCTACCCAACTTTCTT
GTACAAAGTGGTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAA
CTTCCATCCTTGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGT
GGAGCCGGTGGACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTA
TGCGGGCTATCCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATG
ACGTTCCAGATTACGCTTGA
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCD
YKKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRR
HHRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENE
VDLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASL
HKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRT
DDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFF
ATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIEC
KCGTESCRKYLFYPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAG
GAGGPAGLIYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index