Stock Number Hs1393

Human Gene: RASSF8


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
RASSF8 Ras association domain family member 8 HGNC:13232 12p12.1 RASSF8 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03654 pGW-HA.attB ENST00000541218.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166197984798

Sequences

DNA sequence (1410 bp) Protein sequence (470 aa)
ATGGAACTTAAAGTATGGGTGGATGGAGTTCAGAGGATTGTTTGTGGAGT
CACTGAAGTCACAACTTGCCAGGAGGTTGTCATAGCCTTAGCTCAAGCAA
TAGGTCGAACTGGAAGGTACACCCTTATAGAGAAATGGAGAGATACTGAA
AGACACTTAGCACCTCATGAAAATCCTATCATATCCTTAAACAAATGGGG
GCAGTATGCTAGTGATGTGCAGCTCATTCTACGACGAACTGGGCCGTCTC
TCAGTGAGCGACCCACTTCAGACAGTGTGGCTCGAATTCCTGAAAGAACT
TTATACAGGCAGAGTCTGCCCCCCTTAGCTAAACTGAGGCCTCAGATTGA
CAAATCAATCAAAAGGAGGGAACCGAAAAGGAAATCACTGACATTTACAG
GAGGTGCCAAAGGATTAATGGACATTTTTGGAAAAGGTAAAGAAACTGAG
TTTAAGCAAAAGGTGCTGAATAACTGCAAAACAACAGCAGATGAGTTGAA
GAAGCTAATCCGTCTGCAGACAGAGAAGCTTCAATCCATTGAGAAACAGC
TGGAATCTAATGAAATAGAAATAAGATTTTGGGAGCAAAAGTATAATTCC
AACCTTGAAGAGGAAATTGTCCGTCTAGAGCAAAAGATCAAAAGAAACGA
TGTAGAAATTGAGGAGGAAGAATTCTGGGAAAATGAATTACAGATTGAAC
AGGAAAATGAAAAACAGCTGAAGGATCAACTTCAAGAAATAAGACAGAAA
ATAACAGAATGTGAAAACAAATTAAAGGACTATTTGGCACAGATCCGGAC
TATGGAAAGTGGTCTTGAAGCAGAAAAATTGCAACGGGAAGTTCAAGAGG
CACAGGTCAATGAGGAAGAGGTTAAAGGAAAGATCGGTAAGGTCAAAGGG
GAGATTGACATTCAAGGCCAGCAGAGTCTGAGGTTGGAAAATGGCATCAA
AGCTGTGGAAAGATCTCTTGGACAAGCCACCAAACGCTTACAGGACAAAG
AACAGGAACTGGAGCAGTTGACTAAGGAGTTGCGGCAAGTCAATCTCCAG
CAGTTCATCCAGCAGACAGGGACAAAAGTTACCGTTTTGCCAGCGGAGCC
CATTGAAATAGAGGCCTCACATGCAGACATTGAAAGGGGGATCATCATTC
TTTCTGATAAGCAGGAGTGTAAAGATTACCCAACTTTCTTGTACAAAGTG
GTGGTACCTCGAAGTTCCTATTCTCTACTTAGTATAGGAACTTCCATCCT
TGGAGCTCCTTCAGGAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTG
GACCTGCGGGGTTAATTTACCCATACGATGTTCCTGACTATGCGGGCTAT
CCCTATGACGTCCCGGACTATGCAGGATCCTATCCATATGACGTTCCAGA
TTACGCTTGA
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTE
RHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERT
LYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAKGLMDIFGKGKETE
FKQKVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNS
NLEEEIVRLEQKIKRNDVEIEEEEFWENELQIEQENEKQLKDQLQEIRQK
ITECENKLKDYLAQIRTMESGLEAEKLQREVQEAQVNEEEVKGKIGKVKG
EIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQ
QFIQQTGTKVTVLPAEPIEIEASHADIERGIIILSDKQECKDYPTFLYKV
VVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGY
PYDVPDYAGSYPYDVPDYA*

Index