Stock Number Hs1392

Human Gene: NSMCE3


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
NSMCE3 NSE3 homolog, SMC5-SMC6 complex component HGNC:7677 15q13.1 MAGE 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO02628 pGW-HA.attB Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166197884797

Sequences

DNA sequence (1146 bp) Protein sequence (382 aa)
ATGTTGCAAAAACCGAGGAACCGGGGCCGCTCTGGCGGCCAGGCCGAGAG
GGACAGAGACTGGAGCCATAGCGGAAACCCCGGGGCTTCGCGGGCCGGGG
AAGACGCCCGGGTTCTCAGAGACGGCTTTGCCGAGGAGGCCCCGAGCACG
TCCCGCGGGCCGGGCGGCTCGCAGGGGTCGCAGGGCCCCTCGCCTCAGGG
CGCCCGCCGGGCCCAGGCCGCCCCCGCCGTGGGGCCCAGGAGCCAGAAGC
AGCTGGAGCTGAAAGTGTCCGAGCTGGTGCAGTTCTTGCTGATTAAAGAC
CAGAAGAAGATTCCGATCAAGCGGGCCGACATACTGAAGCACGTCATCGG
GGACTACAAGGACATCTTCCCCGACCTCTTCAAACGGGCCGCCGAGCGCC
TCCAGTACGTCTTCGGGTATAAGCTGGTGGAACTTGAACCCAAGAGCAAC
ACTTACATCCTCATCAACACCCTGGAGCCTGTGGAGGAGGATGCCGAGAT
GAGGGGTGACCAAGGCACGCCCACTACGGGCCTCCTGATGATCGTCTTAG
GGCTCATCTTTATGAAGGGCAACACCATCAAGGAAACTGAAGCCTGGGAC
TTTCTGCGGCGCTTAGGGGTCTACCCCACCAAGAAGCATTTAATTTTCGG
AGATCCAAAGAAACTCATTACTGAGGACTTTGTGCGACAGCGTTACCTGG
AATACCGGCGGATACCCCACACCGACCCCGTCGACTACGAATTCCAGTGG
GGCCCGCGAACCAACCTGGAAACCAGCAAGATGAAAGTTCTTAAGTTTGT
GGCCAAGGTCCATAATCAAGACCCCAAGGACTGGCCAGCGCAGTACTGTG
AGGCTTTGGCAGATGAGGAGAACAGGGCCAGACCTCAGCCTAGTGGCCCA
GCTCCATCCTCTTGCCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAG
TTCCTATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAG
GAGGCGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTA
ATTTACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCC
GGACTATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPST
SRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKD
QKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSN
TYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWD
FLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQW
GPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGP
APSSCPTFLYKVVVPRSSYSLLSIGTSILGAPSGGGATAGAGGAGGPAGL
IYPYDVPDYAGYPYDVPDYAGSYPYDVPDYA*

Index