Stock Number Hs1390

Human Gene: ACPP


Gene Information

Human Gene Full Name HGNC Location Fly Gene Chr
ACPP acid phosphatase, prostate HGNC:125 3q22.1 Acph-1 3R

Construct Information

Source Clone ID Accession Cloning Vector Transcript ID Reference/Variant AA Change Base Change Open/Closed
Celniker Lab hGUHO03724 pGW-HA.attB ENST00000495911.5 Reference Open

Stocks

Docking Site DGRC BDSC FBti
VK37166197684796

Sequences

DNA sequence (1392 bp) Protein sequence (464 aa)
ATGAGAGCTGCACCCCTCCTCCTGGCCAGGGCAGCAAGCCTTAGCCTTGG
CTTCTTGTTTCTGCTTTTTTTCTGGCTAGACCGAAGTGTACTAGCCAAGG
AGTTGAAGTTTGTGACTTTGGTGTTTCGGCATGGAGACCGAAGTCCCATT
GACACCTTTCCCACTGACCCCATAAAGGAATCCTCATGGCCACAAGGATT
TGGCCAACTCACCCAGCTGGGCATGGAGCAGCATTATGAACTTGGAGAGT
ATATAAGAAAGAGATATAGAAAATTCTTGAATGAGTCCTATAAACATGAA
CAGGTTTATATTCGAAGCACAGACGTTGACCGGACTTTGATGAGTGCTAT
GACAAACCTGGCAGCCCTGTTTCCCCCAGAAGGTGTCAGCATCTGGAATC
CTATCCTACTCTGGCAGCCCATCCCGGTGCACACAGTTCCTCTTTCTGAA
GATCAGTTGCTATACCTGCCTTTCAGGAACTGCCCTCGTTTTCAAGAACT
TGAGAGTGAGACTTTGAAATCAGAGGAATTCCAGAAGAGGCTGCACCCTT
ATAAGGATTTTATAGCTACCTTGGGAAAACTTTCAGGATTACATGGCCAG
GACCTTTTTGGAATTTGGAGTAAAGTCTACGACCCTTTATATTGTGAGAG
TGTTCACAATTTCACTTTACCCTCCTGGGCCACTGAGGACACCATGACTA
AGTTGAGAGAATTGTCAGAATTGTCCCTCCTGTCCCTCTATGGAATTCAC
AAGCAGAAAGAGAAATCTAGGCTCCAAGGGGGTGTCCTGGTCAATGAAAT
CCTCAATCACATGAAGAGAGCAACTCAGATACCAAGCTACAAAAAACTTA
TCATGTATTCTGCGCATGACACTACTGTGAGTGGCCTACAGATGGCGCTA
GATGTTTACAACGGACTCCTTCCTCCCTATGCTTCTTGCCACTTGACGGA
ATTGTACTTTGAGAAGGGGGAGTACTTTGTGGAGATGCACTATCGGAATG
AGACGCAGCACGAGCCGTATCCCCTCATGCTACCTGGCTGCAGCCCCAGC
TGTCCTCTGGAGAGGTTTGCTGAGCTGGTTGGCCCTGTGATCCCTCAAGA
CTGGTCCACGGAGTGTATGACCACAAACAGCCATCAAGGTACTGAGGACA
GTACAGATTACCCAACTTTCTTGTACAAAGTGGTGGTACCTCGAAGTTCC
TATTCTCTACTTAGTATAGGAACTTCCATCCTTGGAGCTCCTTCAGGAGG
CGGTGCTACTGCTGGCGCTGGTGGAGCCGGTGGACCTGCGGGGTTAATTT
ACCCATACGATGTTCCTGACTATGCGGGCTATCCCTATGACGTCCCGGAC
TATGCAGGATCCTATCCATATGACGTTCCAGATTACGCTTGA
MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPI
DTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHE
QVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQPIPVHTVPLSE
DQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQ
DLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIH
KQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL
DVYNGLLPPYASCHLTELYFEKGEYFVEMHYRNETQHEPYPLMLPGCSPS
CPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTDYPTFLYKVVVPRSS
YSLLSIGTSILGAPSGGGATAGAGGAGGPAGLIYPYDVPDYAGYPYDVPD
YAGSYPYDVPDYA*

Index